Recombinant Human DPM1 Protein

Images

 
SDS-Page: Recombinant Human DPM1 Protein [H00008813-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human DPM1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 161-260 of Human DPM1

Source: Wheat Germ

Amino Acid Sequence: RKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DPM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DPM1 Protein

  • CDGIEEC 2.4.1.83
  • dolichol monophosphate mannose synthase
  • dolichol-phosphate mannosyltransferase
  • Dolichyl-phosphate beta-D-mannosyltransferase
  • dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
  • DPM synthase
  • Mannose-P-dolichol synthase
  • MPD synthase
  • MPDSDolichol-phosphate mannose synthase

Background

DPM1 - dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-65220
Species: Hu
NBP1-81216
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-32539
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P
NBP2-14246
Species: Hu
Applications: IHC, IHC-P
NB500-330
Species: Hu
Applications: Flow, IHC, IHC-P, IP, B/N, CyTOF-ready
NBP1-62494
Species: Hu
Applications: WB
NBP1-91612
Species: Mu
Applications: WB
NBP2-68873
Species: Hu
Applications: WB, ICC/IF
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
NBP2-75626
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-64688
Species: Hu
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DPM1 Partial Recombinant Protein (H00008813-Q01) (0)

There are no publications for DPM1 Partial Recombinant Protein (H00008813-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPM1 Partial Recombinant Protein (H00008813-Q01) (0)

There are no reviews for DPM1 Partial Recombinant Protein (H00008813-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPM1 Partial Recombinant Protein (H00008813-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DPM1 Partial Recombinant Protein (H00008813-Q01)

Discover related pathways, diseases and genes to DPM1 Partial Recombinant Protein (H00008813-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPM1 Partial Recombinant Protein (H00008813-Q01)

Discover more about diseases related to DPM1 Partial Recombinant Protein (H00008813-Q01).
 

Pathways for DPM1 Partial Recombinant Protein (H00008813-Q01)

View related products by pathway.

PTMs for DPM1 Partial Recombinant Protein (H00008813-Q01)

Learn more about PTMs related to DPM1 Partial Recombinant Protein (H00008813-Q01).

Blogs on DPM1

There are no specific blogs for DPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DPM1 Antibody
NBP1-05034
Emerin Antibody
NBP1-87692

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DPM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DPM1