Recombinant Human DPH2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related DPH2 Peptides and Proteins

Order Details


    • Catalog Number
      H00001802-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DPH2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-111 of Human DPH2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLS

Protein/Peptide Type
Partial Recombinant Protein
Gene
DPH2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DPH2 Protein

  • Diphthamide biosynthesis protein 2 homolog-like 2
  • diphthamide biosynthesis protein 2
  • diptheria toxin resistance protein required for diphthamide biosynthesis-like 2
  • diptheria toxin resistance protein required for diphthamide biosynthesis-like 2(S. cerevisiae)
  • DPH2 homolog (S. cerevisiae)
  • DPH2 homolog
  • DPH2L2diphthamide biosynthesis-like protein 2
  • DPH2-like 2 (S. cerevisiae)
  • DPH2-like 2
  • hsDph2

Background

DPH2 - DPH2 homolog (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56693
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-84276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13934
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87969
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85002
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16321
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
UL-950
Species: Hu
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NBP2-30620
Species: Hu
Applications: IHC, IHC-P
NBP1-85250
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001802-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DPH2 Partial Recombinant Protein (H00001802-Q01) (0)

There are no publications for DPH2 Partial Recombinant Protein (H00001802-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPH2 Partial Recombinant Protein (H00001802-Q01) (0)

There are no reviews for DPH2 Partial Recombinant Protein (H00001802-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DPH2 Partial Recombinant Protein (H00001802-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DPH2 Products

Bioinformatics Tool for DPH2 Partial Recombinant Protein (H00001802-Q01)

Discover related pathways, diseases and genes to DPH2 Partial Recombinant Protein (H00001802-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPH2 Partial Recombinant Protein (H00001802-Q01)

Discover more about diseases related to DPH2 Partial Recombinant Protein (H00001802-Q01).
 

Pathways for DPH2 Partial Recombinant Protein (H00001802-Q01)

View related products by pathway.

PTMs for DPH2 Partial Recombinant Protein (H00001802-Q01)

Learn more about PTMs related to DPH2 Partial Recombinant Protein (H00001802-Q01).

Blogs on DPH2

There are no specific blogs for DPH2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DPH2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DPH2