DPF2 Antibody (2F6) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related DPF2 Primary Antibodies

Order Details


    • Catalog Number
      H00005977-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DPF2 Antibody (2F6) [PE] Summary

Immunogen
DPF2 (AAH14889, 56 a.a. - 155 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARK
Localization
Cytoplasmic and Nuclear. Note=30% nuclear. 70% cytoplasmic.
Specificity
DPF2 - D4, zinc and double PHD fingers family 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DPF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DPF2 Antibody (2F6) [PE]

  • Apoptosis response zinc finger protein
  • D4, zinc and double PHD fingers family 2BAF45D
  • MGC10180
  • Protein requiem
  • REQBRG1-associated factor 45D
  • requiem, apoptosis response zinc finger
  • ubi-d4
  • UBID4requiem, apoptosis response zinc finger gene
  • zinc finger protein ubi-d4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14910
Species: Hu
Applications: WB, IHC, IHC-P
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NB110-40561
Species: Hu
Applications: WB, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF470
Species: Mu
Applications: WB, IHC, Neut
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-47254
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA

Publications for DPF2 Antibody (H00005977-M01PE) (0)

There are no publications for DPF2 Antibody (H00005977-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPF2 Antibody (H00005977-M01PE) (0)

There are no reviews for DPF2 Antibody (H00005977-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DPF2 Antibody (H00005977-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPF2 Products

Bioinformatics Tool for DPF2 Antibody (H00005977-M01PE)

Discover related pathways, diseases and genes to DPF2 Antibody (H00005977-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPF2 Antibody (H00005977-M01PE)

Discover more about diseases related to DPF2 Antibody (H00005977-M01PE).
 

Pathways for DPF2 Antibody (H00005977-M01PE)

View related products by pathway.

PTMs for DPF2 Antibody (H00005977-M01PE)

Learn more about PTMs related to DPF2 Antibody (H00005977-M01PE).
 

Research Areas for DPF2 Antibody (H00005977-M01PE)

Find related products by research area.

Blogs on DPF2

There are no specific blogs for DPF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPF2 Antibody (2F6) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol DPF2