Dopamine D2R/DRD2 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:LRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQML |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DRD2 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For Immunohistochemistry-Paraffin, HIER pH6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Dopamine D2R/DRD2 Antibody
Background
The DRD2 Dopamine Receptor is involved in the neuromodulation of appetitive behaviors. DRD2 may be linked to alcoholism and other substance-use disorders. Mutations in DRD2 in mice lead to the suppression of reward behavior with morphine and to the reduction of spontaneous movements, a phenotype resembling Parkinson's disease. Three alternatively spliced isoforms have been identified. DRD2 has been reported to be expressed in various regions of the brain, as well as in aorta, artery, eye, and spinal cord. ESTs have been isolated from normal pituitary and in brain, colon, lung, pancreas, and skeletal muscle cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Publications for Dopamine D2R/DRD2 Antibody (NBP1-87568) (0)
There are no publications for Dopamine D2R/DRD2 Antibody (NBP1-87568).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dopamine D2R/DRD2 Antibody (NBP1-87568) (0)
There are no reviews for Dopamine D2R/DRD2 Antibody (NBP1-87568).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Dopamine D2R/DRD2 Antibody (NBP1-87568) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dopamine D2R/DRD2 Products
Research Areas for Dopamine D2R/DRD2 Antibody (NBP1-87568)
Find related products by research area.
|
Blogs on Dopamine D2R/DRD2