Dopamine D2 R/DRD2 Antibody (1B11)

Images

 
Western Blot: Dopamine D2 R/DRD2 Antibody (1B11) [H00001813-M01A] - DRD2 monoclonal antibody (M01A), clone 1B11 Analysis of DRD2 expression in HL-60.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dopamine D2 R/DRD2 Antibody (1B11) Summary

Immunogen
DRD2 (AAH21195, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIF
Specificity
DRD2 - dopamine receptor D2 (1B11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DRD2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001813-M01A.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Ascites
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dopamine D2 R/DRD2 Antibody (1B11)

  • D(2) dopamine receptor
  • D2DR
  • D2R
  • Dopamine D2 R
  • Dopamine D2 receptor
  • Dopamine D2R
  • dopamine receptor D2 isoform
  • dopamine receptor D2
  • DRD2
  • seven transmembrane helix receptor

Background

This gene encodes the D2 subtype of the dopamine receptor. This G-protein coupled receptor inhibits adenylyl cyclase activity. A missense mutation in this gene causes myoclonus dystonia; other mutations have been associated with schizophrenia. Alternative splicing of this gene results in two transcript variants encoding different isoforms. A third variant has been described, but it has not been determined whether this form is normal or due to aberrant splicing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB600-961
Species: Hu
Applications: WB, IP
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60017
Species: Mu, Rt, Bv(-), Ca(-), Hu(-), Po(-), Rb(-), Sh(-)
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NLS3921
Species: Hu, Mk, Pm
Applications: IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)(1)

Reviews for Dopamine D2 R/DRD2 Antibody (H00001813-M01A) (0)

There are no reviews for Dopamine D2 R/DRD2 Antibody (H00001813-M01A). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dopamine D2 R/DRD2 Antibody (H00001813-M01A) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)

Discover related pathways, diseases and genes to Dopamine D2 R/DRD2 Antibody (H00001813-M01A). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)

Discover more about diseases related to Dopamine D2 R/DRD2 Antibody (H00001813-M01A).
 

Pathways for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)

View related products by pathway.

PTMs for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)

Learn more about PTMs related to Dopamine D2 R/DRD2 Antibody (H00001813-M01A).
 

Research Areas for Dopamine D2 R/DRD2 Antibody (H00001813-M01A)

Find related products by research area.

Blogs on Dopamine D2 R/DRD2

There are no specific blogs for Dopamine D2 R/DRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dopamine D2 R/DRD2 Antibody (1B11) and receive a gift card or discount.

Bioinformatics

Gene Symbol DRD2
Entrez
Uniprot