Dopamine D1 R/DRD1 Antibody

Images

 
Immunohistochemistry-Paraffin: Dopamine D1 R/DRD1 Antibody [NBP1-87577] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dopamine D1 R/DRD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RIAQKQIRRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DRD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Dopamine D1 R/DRD1 Recombinant Protein Antigen (NBP1-87577PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dopamine D1 R/DRD1 Antibody

  • D(1A) dopamine receptor
  • D1DR
  • DADR
  • Dopamine D1 R
  • Dopamine D1 receptor
  • Dopamine D1R
  • dopamine receptor D1
  • DRD1
  • DRD1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00001815-R02
Species: Hu
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60019
Species: Mu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-87577
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Dopamine D1 R/DRD1 Antibody (NBP1-87577) (0)

There are no publications for Dopamine D1 R/DRD1 Antibody (NBP1-87577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dopamine D1 R/DRD1 Antibody (NBP1-87577) (0)

There are no reviews for Dopamine D1 R/DRD1 Antibody (NBP1-87577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Dopamine D1 R/DRD1 Antibody (NBP1-87577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dopamine D1 R/DRD1 Products

Bioinformatics Tool for Dopamine D1 R/DRD1 Antibody (NBP1-87577)

Discover related pathways, diseases and genes to Dopamine D1 R/DRD1 Antibody (NBP1-87577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dopamine D1 R/DRD1 Antibody (NBP1-87577)

Discover more about diseases related to Dopamine D1 R/DRD1 Antibody (NBP1-87577).
 

Pathways for Dopamine D1 R/DRD1 Antibody (NBP1-87577)

View related products by pathway.

PTMs for Dopamine D1 R/DRD1 Antibody (NBP1-87577)

Learn more about PTMs related to Dopamine D1 R/DRD1 Antibody (NBP1-87577).
 

Research Areas for Dopamine D1 R/DRD1 Antibody (NBP1-87577)

Find related products by research area.

Blogs on Dopamine D1 R/DRD1

There are no specific blogs for Dopamine D1 R/DRD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dopamine D1 R/DRD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DRD1
Entrez