Recombinant Human Dopamine beta-Hydroxylase Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Dopamine beta-Hydroxylase Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 494-603 of Human Dopamine beta-Hydroxylase

Source: Wheat Germ

Amino Acid Sequence: DAGFLQKYFHLINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
DBH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dopamine beta-Hydroxylase Protein

  • DBH
  • DBM
  • dopamine beta-hydroxylase (dopamine beta-monooxygenase)
  • Dopamine betaHydroxylase
  • Dopamine beta-Hydroxylase
  • Dopamine beta-monooxygenase
  • DOPBHY
  • EC 1.14.17.1

Background

DBH - dopamine beta-hydroxylase (dopamine beta-monooxygenase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-31329
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-14817
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
H00001621-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01) (0)

There are no publications for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01) (0)

There are no reviews for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01)

Discover related pathways, diseases and genes to Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01)

Discover more about diseases related to Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01).
 

Pathways for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01)

View related products by pathway.

PTMs for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01)

Learn more about PTMs related to Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01).
 

Research Areas for Dopamine beta-Hydroxylase Partial Recombinant Protein (H00001621-Q01)

Find related products by research area.

Blogs on Dopamine beta-Hydroxylase

There are no specific blogs for Dopamine beta-Hydroxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dopamine beta-Hydroxylase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DBH