DOCK10 Antibody

Images

 
Immunohistochemistry-Paraffin: DOCK10 Antibody [NBP1-82969] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOCK10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDTSFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOCK10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DOCK10 Protein (NBP1-82969PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOCK10 Antibody

  • dedicator of cytokinesis 10
  • dedicator of cytokinesis protein 10
  • DKFZp781A1532
  • DRIP2
  • KIAA0694protein zizimin 3
  • Nbla10300
  • ZIZ3dopamine receptor interacting protein 2
  • zizimin3
  • zizimin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32488
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29464
Species: Hu, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00005956-R02
Species: Hu
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38517
Species: Hu
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-82969
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DOCK10 Antibody (NBP1-82969) (0)

There are no publications for DOCK10 Antibody (NBP1-82969).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK10 Antibody (NBP1-82969) (0)

There are no reviews for DOCK10 Antibody (NBP1-82969). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DOCK10 Antibody (NBP1-82969) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOCK10 Products

Bioinformatics Tool for DOCK10 Antibody (NBP1-82969)

Discover related pathways, diseases and genes to DOCK10 Antibody (NBP1-82969). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK10 Antibody (NBP1-82969)

Discover more about diseases related to DOCK10 Antibody (NBP1-82969).
 

Pathways for DOCK10 Antibody (NBP1-82969)

View related products by pathway.

PTMs for DOCK10 Antibody (NBP1-82969)

Learn more about PTMs related to DOCK10 Antibody (NBP1-82969).

Blogs on DOCK10

There are no specific blogs for DOCK10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK10