DNMT3B Antibody



Product Details

Product Discontinued
View other related DNMT3B Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNMT3B Antibody Summary

Synthetic peptides corresponding to DNMT3B(DNA (cytosine-5-)-methyltransferase 3 beta) The peptide sequence was selected from the middle region of DNMT3B. Peptide sequence GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against DNMT3B and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
86 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, IHC-WhMt
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for DNMT3B Antibody (NBP1-54350) (0)

There are no publications for DNMT3B Antibody (NBP1-54350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNMT3B Antibody (NBP1-54350) (0)

There are no reviews for DNMT3B Antibody (NBP1-54350). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for DNMT3B Antibody (NBP1-54350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNMT3B Antibody Products

Related Products by Gene

Bioinformatics Tool for DNMT3B Antibody (NBP1-54350)

Discover related pathways, diseases and genes to DNMT3B Antibody (NBP1-54350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNMT3B Antibody (NBP1-54350)

Discover more about diseases related to DNMT3B Antibody (NBP1-54350).

Pathways for DNMT3B Antibody (NBP1-54350)

View related products by pathway.

PTMs for DNMT3B Antibody (NBP1-54350)

Learn more about PTMs related to DNMT3B Antibody (NBP1-54350).

Blogs on DNMT3B.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Go Ahead! Make My DNA
DNA methylation plays a critical role the long-term silencing of transcription and is essential for processes such as embryonic development, germline differentiation, and tissue maturation. Dnmt3a is a member of the C5-methyltransferase family that re...  Read full blog post.

Controlling Epigenetic Signaling with Dnmt1 and Dnmt3b
Dnmt1 belongs to the C5-methyltransferase family that repairs cytosines in dsDNA using a nucleophilic attack mechanism. Dnmt1 is the most abundant mammalian DNA methyltransferase. It is the key methylation maintenance enzyme for both DNA replication/r...  Read full blog post.

DNMT3B: Roles in Leukemia
DNA-methyltransferase 3B (DNMT3B), also known as DNA methyltransferase HsaIIIB, is a member of the class I-like SAM-binding methyltransferase superfamily and C5-methyltransferase family. DNMT3B plays an essential role in the establishment of DNA methy...  Read full blog post.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol DNMT3B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-54350 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.