DNMT3B Antibody

Images

 
Western Blot: DNMT3B Antibody [NBP1-54350] - Sample Type : Lane 1: 20 ug mouse mesenchymal stem cell lysate Primary Antibody Dilution : 1:2000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:10,000 ...read more
Western Blot: DNMT3B Antibody [NBP1-54350] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Summary
Product Discontinued
View other related DNMT3B Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNMT3B Antibody Summary

Immunogen
Synthetic peptides corresponding to DNMT3B(DNA (cytosine-5-)-methyltransferase 3 beta) The peptide sequence was selected from the middle region of DNMT3B. Peptide sequence GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC.
Clonality
Polyclonal
Host
Rabbit
Gene
DNMT3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DNMT3B and was validated on Western blot.
Theoretical MW
86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNMT3B Antibody

  • DNA (cytosine-5-)-methyltransferase 3 beta
  • DNA (cytosine-5)-methyltransferase 3B
  • DNA methyltransferase HsaIIIB
  • DNA MTase HsaIIIB
  • DNMT3B
  • EC 2.1.1.37
  • ICF
  • ICF1
  • M.HsaIIIB

Background

DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27098
Species: Hu, Pm
Applications: WB, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB200-616
Species: Hu, Mu
Applications: WB
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for DNMT3B Antibody (NBP1-54350) (0)

There are no publications for DNMT3B Antibody (NBP1-54350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNMT3B Antibody (NBP1-54350) (0)

There are no reviews for DNMT3B Antibody (NBP1-54350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNMT3B Antibody (NBP1-54350). (Showing 1 - 1 of 1 FAQ).

  1. I'd like to know if this antibody (catalog # NBP1-00783) is likely to cross-react with DNMT3a? Also, I'd like to use it to detect marsupial DNMT3b (XP_003757074.1) by WB and IHC-P. Is it likely to cross-react with this? Or with marsupial DNMT3a (XP_003757846)?
    • Our best antibody to Dnmt3b is NB100-266 but unfortunately, neither NB100-266 nor NBP1-00783 are predicted to cross-react with your species. NBP1-54350 is predicted to cross-react react with marsupial, but the immunogen also shares 86% identity with human and marsupial Dnmt3a. NBP1-54350 would have to be the antibody I most recommend.

Secondary Antibodies

 

Isotype Controls

Additional DNMT3B Products

Bioinformatics Tool for DNMT3B Antibody (NBP1-54350)

Discover related pathways, diseases and genes to DNMT3B Antibody (NBP1-54350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNMT3B Antibody (NBP1-54350)

Discover more about diseases related to DNMT3B Antibody (NBP1-54350).
 

Pathways for DNMT3B Antibody (NBP1-54350)

View related products by pathway.

PTMs for DNMT3B Antibody (NBP1-54350)

Learn more about PTMs related to DNMT3B Antibody (NBP1-54350).
 

Research Areas for DNMT3B Antibody (NBP1-54350)

Find related products by research area.

Blogs on DNMT3B.

The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies
Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w...  Read full blog post.

The role of DNMT3A in development
Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence.  Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation.  Gene silencing in DNA ...  Read full blog post.

Go Ahead! Make My DNA
DNA methylation plays a critical role the long-term silencing of transcription and is essential for processes such as embryonic development, germline differentiation, and tissue maturation. Dnmt3a is a member of the C5-methyltransferase family that re...  Read full blog post.

Controlling Epigenetic Signaling with Dnmt1 and Dnmt3b
Dnmt1 belongs to the C5-methyltransferase family that repairs cytosines in dsDNA using a nucleophilic attack mechanism. Dnmt1 is the most abundant mammalian DNA methyltransferase. It is the key methylation maintenance enzyme for both DNA replication/r...  Read full blog post.

DNMT3B: Roles in Leukemia
DNA-methyltransferase 3B (DNMT3B), also known as DNA methyltransferase HsaIIIB, is a member of the class I-like SAM-binding methyltransferase superfamily and C5-methyltransferase family. DNMT3B plays an essential role in the establishment of DNA methy...  Read full blog post.

Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process
We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNMT3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNMT3B
Entrez
Uniprot