Dnmt2 Antibody

Images

 
Western Blot: Dnmt2 Antibody [NBP1-53132] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dnmt2 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRDMT1(tRNA aspartic acid methyltransferase 1) The peptide sequence was selected from the N terminal of TRDMT1. Peptide sequence MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRDMT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRDMT1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dnmt2 Antibody

  • DMNT2
  • DNA (cytosine-5-)-methyltransferase 2
  • DNA (cytosine-5)-methyltransferase-like protein 2
  • DNA methyltransferase homolog HsaIIP
  • DNA methyltransferase-2
  • DNA MTase homolog HsaIIP
  • DNMT2
  • EC 2.1.1
  • EC 2.1.1.29
  • M.HsaIIP
  • MHSAIIP
  • PUMET
  • RNMT1
  • tRNA (cytosine-5-)-methyltransferase
  • tRNA aspartic acid methyltransferase 1

Background

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome.CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27098
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-86878
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-53132
Species: Hu
Applications: WB

Publications for Dnmt2 Antibody (NBP1-53132) (0)

There are no publications for Dnmt2 Antibody (NBP1-53132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dnmt2 Antibody (NBP1-53132) (0)

There are no reviews for Dnmt2 Antibody (NBP1-53132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dnmt2 Antibody (NBP1-53132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dnmt2 Products

Bioinformatics Tool for Dnmt2 Antibody (NBP1-53132)

Discover related pathways, diseases and genes to Dnmt2 Antibody (NBP1-53132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dnmt2 Antibody (NBP1-53132)

Discover more about diseases related to Dnmt2 Antibody (NBP1-53132).
 

Pathways for Dnmt2 Antibody (NBP1-53132)

View related products by pathway.

PTMs for Dnmt2 Antibody (NBP1-53132)

Learn more about PTMs related to Dnmt2 Antibody (NBP1-53132).
 

Research Areas for Dnmt2 Antibody (NBP1-53132)

Find related products by research area.

Blogs on Dnmt2

There are no specific blogs for Dnmt2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dnmt2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRDMT1
Uniprot