Dnmt2 Antibody


Western Blot: Dnmt2 Antibody [NBP1-53132] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Dnmt2 Antibody Summary

Synthetic peptides corresponding to TRDMT1(tRNA aspartic acid methyltransferase 1) The peptide sequence was selected from the N terminal of TRDMT1. Peptide sequence MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRDMT1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dnmt2 Antibody

  • DMNT2
  • DNA (cytosine-5-)-methyltransferase 2
  • DNA (cytosine-5)-methyltransferase-like protein 2
  • DNA methyltransferase homolog HsaIIP
  • DNA methyltransferase-2
  • DNA MTase homolog HsaIIP
  • DNMT2
  • EC 2.1.1
  • EC
  • M.HsaIIP
  • RNMT1
  • tRNA (cytosine-5-)-methyltransferase
  • tRNA aspartic acid methyltransferase 1


CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. TRDMT1 is a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome.CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a protein with similarity to DNA methyltransferases, but this protein does not display methyltransferase activity. The protein strongly binds DNA, suggesting that it may mark specific sequences in the genome. Alternative splicing results in multiple transcript variants encoding different isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Dnmt2 Antibody (NBP1-53132) (0)

There are no publications for Dnmt2 Antibody (NBP1-53132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dnmt2 Antibody (NBP1-53132) (0)

There are no reviews for Dnmt2 Antibody (NBP1-53132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dnmt2 Antibody (NBP1-53132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Dnmt2 Products

Bioinformatics Tool for Dnmt2 Antibody (NBP1-53132)

Discover related pathways, diseases and genes to Dnmt2 Antibody (NBP1-53132). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dnmt2 Antibody (NBP1-53132)

Discover more about diseases related to Dnmt2 Antibody (NBP1-53132).

Pathways for Dnmt2 Antibody (NBP1-53132)

View related products by pathway.

PTMs for Dnmt2 Antibody (NBP1-53132)

Learn more about PTMs related to Dnmt2 Antibody (NBP1-53132).

Research Areas for Dnmt2 Antibody (NBP1-53132)

Find related products by research area.

Blogs on Dnmt2

There are no specific blogs for Dnmt2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dnmt2 Antibody and receive a gift card or discount.


Gene Symbol TRDMT1