DNCIC1 Antibody


Western Blot: DNCIC1 Antibody [NBP1-56696] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.

Product Details

Product Discontinued
View other related DNCIC1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNCIC1 Antibody Summary

Synthetic peptides corresponding to DYNC1I1(dynein, cytoplasmic 1, intermediate chain 1) The peptide sequence was selected from the N terminal of DYNC1I1. Peptide sequence GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DYNC1I1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNCIC1 Antibody

  • cytoplasmic dynein 1 intermediate chain 1
  • Cytoplasmic dynein intermediate chain 1
  • DNCI1cytoplasmic, intermediate polypeptide 1
  • Dynein intermediate chain 1, cytosolic
  • dynein, cytoplasmic 1, intermediate chain 1


The aldehyde dehydrogenases are a family of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3B1 is highly expressed in kidney and lung.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB

Publications for DNCIC1 Antibody (NBP1-56696) (0)

There are no publications for DNCIC1 Antibody (NBP1-56696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNCIC1 Antibody (NBP1-56696) (0)

There are no reviews for DNCIC1 Antibody (NBP1-56696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNCIC1 Antibody (NBP1-56696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DNCIC1 Antibody (NBP1-56696)

Discover related pathways, diseases and genes to DNCIC1 Antibody (NBP1-56696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNCIC1 Antibody (NBP1-56696)

Discover more about diseases related to DNCIC1 Antibody (NBP1-56696).

Pathways for DNCIC1 Antibody (NBP1-56696)

View related products by pathway.

Research Areas for DNCIC1 Antibody (NBP1-56696)

Find related products by research area.

Blogs on DNCIC1

There are no specific blogs for DNCIC1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DNCIC1 Antibody and receive a gift card or discount.


Gene Symbol DYNC1I1