DNAJC7 Antibody (4G6-G3) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related DNAJC7 Primary Antibodies

Order Details


    • Catalog Number
      H00007266-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNAJC7 Antibody (4G6-G3) [PE] Summary

Immunogen
DNAJC7 (AAH33772, 1 a.a. - 484 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Specificity
DNAJC7 - DnaJ (Hsp40) homolog, subfamily C, member 7
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJC7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC7 Antibody (4G6-G3) [PE]

  • DANJC7
  • DJ11
  • DnaJ (Hsp40) homolog, subfamily C, member 7
  • tetratricopeptide repeat domain 2
  • Tetratricopeptide repeat protein 2
  • TPR repeat protein 2
  • TPR2DJC7
  • TTC2dnaJ homolog subfamily C member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-86921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-97503
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Md, Pm, Rb, Sh, Xp
Applications: WB, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
NB120-13600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007266-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for DNAJC7 Antibody (H00007266-M01PE) (0)

There are no publications for DNAJC7 Antibody (H00007266-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC7 Antibody (H00007266-M01PE) (0)

There are no reviews for DNAJC7 Antibody (H00007266-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC7 Antibody (H00007266-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC7 Products

Bioinformatics Tool for DNAJC7 Antibody (H00007266-M01PE)

Discover related pathways, diseases and genes to DNAJC7 Antibody (H00007266-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC7 Antibody (H00007266-M01PE)

Discover more about diseases related to DNAJC7 Antibody (H00007266-M01PE).
 

Pathways for DNAJC7 Antibody (H00007266-M01PE)

View related products by pathway.

Blogs on DNAJC7

There are no specific blogs for DNAJC7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC7 Antibody (4G6-G3) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC7