DNAJC3 Antibody (4D3-F2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related DNAJC3 Primary Antibodies

Order Details


    • Catalog Number
      H00005611-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNAJC3 Antibody (4D3-F2) [DyLight 488] Summary

Immunogen
DNAJC3 (AAH33823, 1 a.a. - 234 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Marker
ER Stress Marker
Specificity
DNAJC3 - DnaJ (Hsp40) homolog, subfamily C, member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJC3 Antibody (4D3-F2) [DyLight 488]

  • DnaJ (Hsp40) homolog, subfamily C, member 3
  • HP58
  • Interferon-induced, double-stranded RNA-activated protein kinase inhibitor
  • P58FLJ21288
  • P58IPKProtein kinase inhibitor p58
  • PRKRIdnaJ homolog subfamily C member 3
  • Protein kinase inhibitor of 58 kDa
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NB100-495
Species: Hu
Applications: WB
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-90034
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for DNAJC3 Antibody (H00005611-M01G) (0)

There are no publications for DNAJC3 Antibody (H00005611-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC3 Antibody (H00005611-M01G) (0)

There are no reviews for DNAJC3 Antibody (H00005611-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC3 Antibody (H00005611-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC3 Products

Bioinformatics Tool for DNAJC3 Antibody (H00005611-M01G)

Discover related pathways, diseases and genes to DNAJC3 Antibody (H00005611-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC3 Antibody (H00005611-M01G)

Discover more about diseases related to DNAJC3 Antibody (H00005611-M01G).
 

Pathways for DNAJC3 Antibody (H00005611-M01G)

View related products by pathway.

PTMs for DNAJC3 Antibody (H00005611-M01G)

Learn more about PTMs related to DNAJC3 Antibody (H00005611-M01G).
 

Research Areas for DNAJC3 Antibody (H00005611-M01G)

Find related products by research area.

Blogs on DNAJC3

There are no specific blogs for DNAJC3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC3 Antibody (4D3-F2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC3