DNAJB2 Antibody (2C9) [DyLight 350]

Images

 

Product Details

Summary
Product Discontinued
View other related DNAJB2 Primary Antibodies

Order Details


    • Catalog Number
      H00003300-M03UV
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNAJB2 Antibody (2C9) [DyLight 350] Summary

Immunogen
DNAJB2 (NP_006727 216 a.a. - 324 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LELSRREQQPSVTSRSGGTQVQQTPASCPLDSDLSEDEDLQLAMAYSLSEMEAAGKKPAGGREAQHRRQGRPKAQHQDPGLGGTQEGARGEATKRSPSPEEKASRCLIL
Specificity
DNAJB2 - DnaJ (Hsp40) homolog, subfamily B, member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJB2 Antibody (2C9) [DyLight 350]

  • DnaJ (Hsp40) homolog, subfamily B, member 2
  • HSJ-1
  • HSPF3neuronal DNAJ-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NB100-77316
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00006532-M06
Species: Hu
Applications: ELISA, IP
NB600-952
Species: Hu, Mu, Rt, Po, Ba, Ha, Pm, Rb
Applications: WB, Flow, IHC, IHC-P, IP, IF
AF5119
Species: Hu
Applications: WB
NBP1-84899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00003300-M03UV
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for DNAJB2 Antibody (H00003300-M03UV) (0)

There are no publications for DNAJB2 Antibody (H00003300-M03UV).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJB2 Antibody (H00003300-M03UV) (0)

There are no reviews for DNAJB2 Antibody (H00003300-M03UV). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJB2 Antibody (H00003300-M03UV) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJB2 Products

Bioinformatics Tool for DNAJB2 Antibody (H00003300-M03UV)

Discover related pathways, diseases and genes to DNAJB2 Antibody (H00003300-M03UV). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJB2 Antibody (H00003300-M03UV)

Discover more about diseases related to DNAJB2 Antibody (H00003300-M03UV).
 

Pathways for DNAJB2 Antibody (H00003300-M03UV)

View related products by pathway.

PTMs for DNAJB2 Antibody (H00003300-M03UV)

Learn more about PTMs related to DNAJB2 Antibody (H00003300-M03UV).

Blogs on DNAJB2

There are no specific blogs for DNAJB2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJB2 Antibody (2C9) [DyLight 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJB2