DNAJA4 Antibody (4B4-1F2) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related DNAJA4 Primary Antibodies

Order Details


    • Catalog Number
      H00055466-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNAJA4 Antibody (4B4-1F2) [DyLight 680] Summary

Immunogen
DNAJA4 (AAH21720, 1 a.a. ~ 398 a.a) full length recombinant protein with GST tag.MVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG EKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGGSGSPSFSS PMDIFDMFFGGGGRMARERRGKNVVHQLSVTLEDLYNGVTKK LALQKNVICEKCEGVGGKKGSVEKCPLCKGRGMQIHIQQIGP GMVQQIQTVCIECKGQGERINPKDRCESCSGAKVIREKKIIE VHVEKGMKDGQKILFHGEGDQEPELEPGDVIIVLD
Localization
Membrane. Lipid-anchor.
Specificity
DNAJA4 - DnaJ (Hsp40) homolog, subfamily A, member 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DNAJA4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNAJA4 Antibody (4B4-1F2) [DyLight 680]

  • DnaJ (Hsp40) homolog, subfamily A, member 4
  • dnaJ homolog subfamily A member 4
  • MST104
  • MSTP104
  • PRO1472

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-952
Species: Hu, Mu, Rt, Po, Ba, Ha, Pm, Rb
Applications: WB, Flow, IHC, IHC-P, IP, IF
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32010
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
1341-WF/CF
Species: Hu
NBP2-57648
Species: Hu
Applications: WB, ICC/IF
NBP1-81735
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3760
Species: Hu
Applications: WB
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-27398
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-84969
Species: Hu
Applications: IHC, IHC-P
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready

Publications for DNAJA4 Antibody (H00055466-M01FR) (0)

There are no publications for DNAJA4 Antibody (H00055466-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJA4 Antibody (H00055466-M01FR) (0)

There are no reviews for DNAJA4 Antibody (H00055466-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJA4 Antibody (H00055466-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJA4 Products

Bioinformatics Tool for DNAJA4 Antibody (H00055466-M01FR)

Discover related pathways, diseases and genes to DNAJA4 Antibody (H00055466-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJA4 Antibody (H00055466-M01FR)

Discover more about diseases related to DNAJA4 Antibody (H00055466-M01FR).
 

Pathways for DNAJA4 Antibody (H00055466-M01FR)

View related products by pathway.

PTMs for DNAJA4 Antibody (H00055466-M01FR)

Learn more about PTMs related to DNAJA4 Antibody (H00055466-M01FR).

Blogs on DNAJA4

There are no specific blogs for DNAJA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJA4 Antibody (4B4-1F2) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJA4