DNAH10 Antibody

Images

 
Immunohistochemistry: DNAH10 Antibody [NBP2-32631] - Staining of human lung shows strong cytoplasmic positivity in bronchial epithelium.
Immunohistochemistry: DNAH10 Antibody [NBP2-32631] - Staining of human lung shows strong cytoplasmic positivity in bronchial epithelium.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAH10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH10 Protein (NBP2-32631PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH10 Antibody

  • axonemal, heavy polypeptide 10
  • dynein heavy chain 10, axonemal
  • dynein, axonemal, heavy chain 10
  • FLJ38262
  • FLJ43808

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82119
Species: Hu
Applications: IHC, IHC-P
NBP1-54903
Species: Hu
Applications: WB
NBP1-88878
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56858
Species: Hu
Applications: ICC/IF
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5236
Species: Mu
Applications: WB
NBP1-92058
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
NBP1-85886
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBL1-12547
Species: Hu
NB100-298
Species: Hu, Xp
Applications: WB, ICC/IF, PLA
NBP1-77072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-87459
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79438
Species: Hu
Applications: WB
NBP2-32631
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for DNAH10 Antibody (NBP2-32631) (0)

There are no publications for DNAH10 Antibody (NBP2-32631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH10 Antibody (NBP2-32631) (0)

There are no reviews for DNAH10 Antibody (NBP2-32631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH10 Antibody (NBP2-32631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAH10 Products

Bioinformatics Tool for DNAH10 Antibody (NBP2-32631)

Discover related pathways, diseases and genes to DNAH10 Antibody (NBP2-32631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAH10 Antibody (NBP2-32631)

Discover more about diseases related to DNAH10 Antibody (NBP2-32631).

Blogs on DNAH10

There are no specific blogs for DNAH10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH10