DNA Primase small subunit Antibody

Images

 
Western Blot: DNA Primase small subunit Antibody [NBP1-74211] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Product Discontinued
View other related DNA Primase small subunit Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74211
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DNA Primase small subunit Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Prim1. Immunizing peptide sequence EKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSD.
Clonality
Polyclonal
Host
Rabbit
Gene
PRIM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Prim1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DNA Primase small subunit Antibody

  • DNA primase 1
  • DNA primase 49 kDa subunit
  • DNA primase small subunit
  • DNA primase subunit 48
  • EC 2.7.7
  • EC 2.7.7.-
  • MGC12308
  • p49
  • primase p49 subunit
  • primase polypeptide 1, 49kDa
  • primase, DNA, polypeptide 1 (49kDa)

Background

DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58498
Species: Hu
Applications: ICC/IF
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF7250
Species: Hu
Applications: IHC
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-87760
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3770
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92564
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNA Primase small subunit Antibody (NBP1-74211) (0)

There are no publications for DNA Primase small subunit Antibody (NBP1-74211).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNA Primase small subunit Antibody (NBP1-74211) (0)

There are no reviews for DNA Primase small subunit Antibody (NBP1-74211). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DNA Primase small subunit Antibody (NBP1-74211) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNA Primase small subunit Products

Bioinformatics Tool for DNA Primase small subunit Antibody (NBP1-74211)

Discover related pathways, diseases and genes to DNA Primase small subunit Antibody (NBP1-74211). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNA Primase small subunit Antibody (NBP1-74211)

Discover more about diseases related to DNA Primase small subunit Antibody (NBP1-74211).
 

Pathways for DNA Primase small subunit Antibody (NBP1-74211)

View related products by pathway.

PTMs for DNA Primase small subunit Antibody (NBP1-74211)

Learn more about PTMs related to DNA Primase small subunit Antibody (NBP1-74211).

Blogs on DNA Primase small subunit

There are no specific blogs for DNA Primase small subunit, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNA Primase small subunit Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRIM1
Uniprot