DNA Polymerase epsilon subunit 3 Antibody - Azide and BSA Free

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [H00054107-B02P] - Analysis of POLE3 expression in human liver.

Immunocytochemistry/Immunofluorescence: DNA Polymerase epsilon subunit 3 Antibody [H00054107-B02P] - Analysis of purified antibody to POLE3 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: DNA Polymerase epsilon subunit 3 Antibody [H00054107-B02P] - Analysis of POLE3 expression in transfected 293T cell line by POLE3 polyclonal antibody. Lane 1: POLE3 transfected lysate(16.17 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DNA Polymerase epsilon subunit 3 Antibody - Azide and BSA Free Summary

• Immunogen: POLE3 (AAH03166.1, 1 a.a. - 147 a.a.) full-length human protein. MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
• Specificity: POLE3 - polymerase (DNA directed), epsilon 3 (p17 subunit),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: POLE3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DNA Polymerase epsilon subunit 3 Antibody - Azide and BSA Free

• Arsenic-transactivated protein
• asTP
• CHARAC17arsenic transactivated protein
• CHRAC-17
• CHRAC17Ybl1
• Chromatin accessibility complex 17 kDa protein
• DNA polymerase epsilon p17 subunit
• DNA polymerase epsilon subunit 3
• DNA polymerase epsilon subunit p17
• DNA polymerase II subunit 3
• EC 2.7.7.7
• histone fold protein CHRAC17
• huCHRAC17
• p17
• polymerase (DNA directed), epsilon 3 (p17 subunit)
• YBL1

Background

POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNA Polymerase epsilon subunit 3 Antibody (H00054107-B02P)(1)

Publication using H00054107-B02P

• Fenstermaker TK, Petruk S, Kovermann SK et al. RNA polymerase II associates with active genes during DNA replication Nature 2023-07-19 [PMID: 37468626]

Bioinformatics

• Gene Symbol: POLE3
• Uniprot:
  • AAH03166.1(Human)