| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | POLE3 (AAH03166.1, 1 a.a. - 147 a.a.) full-length human protein. MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN |
| Specificity | POLE3 - polymerase (DNA directed), epsilon 3 (p17 subunit), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | POLE3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00054107-B02P | Applications | Species |
|---|---|---|
| Fenstermaker TK, Petruk S, Kovermann SK et al. RNA polymerase II associates with active genes during DNA replication Nature 2023-07-19 [PMID: 37468626] |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNA Polymerase epsilon subunit 3 Antibody (H00054107-B02P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | POLE3 |
| Uniprot |
|