DNA Ligase IV Antibody - BSA Free

Western Blot: DNA Ligase IV Antibody [NB110-57379] - HepG2 cell lysate.

Immunohistochemistry: DNA Ligase IV Antibody [NB110-57379] - Immunohistochemical staining of human pancreatic tissue using NB110-57379 at a concentration of 5 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

DNA Ligase IV Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DNA Ligase IV. Peptide Sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LIG4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Knockdown Validated reported in scientific literature (PMID:32846126)
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  DNA Ligase IV Overexpression Lysate

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32846126).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for DNA Ligase IV Antibody - BSA Free

• DNA joinase
• DNA ligase 4
• DNA Ligase IV
• DNA repair enzyme
• EC 6.5.1.1
• LIG4
• ligase IV, DNA, ATP-dependent
• Polydeoxyribonucleotide synthase [ATP] 4
• polynucleotide ligase
• sealase

Background

LIG4 encodes a DNA ligase that joins single-strand breaks in a double-stranded polydeoxynucleotide in an ATP-dependent reaction. This protein is essential for V(D)J recombination and DNA double-strand break (DSB) repair through nonhomologous end joining (NHEJ). This protein forms a complex with the X-ray repair cross complementing protein 4 (XRCC4), and further interacts with the DNA-dependent protein kinase (DNA-PK). Both XRCC4 and DNA-PK are known to be required for NHEJ. The crystal structure of the complex formed by this protein and XRCC4 has been resolved. Defects in this gene are the cause of LIG4 syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNA Ligase IV Antibody (NB110-57379)(4)

Publications using NB110-57379

• Francica P, Mutlu M, Blomen VA et al. Functional Radiogenetic Profiling Implicates ERCC6L2 in Non-homologous End Joining Cell Rep 2020-08-25 [PMID: 32846126] (WB, KD, Mouse)
• Ching W, Dobner T, Koyuncu E. The human adenovirus type 5 E1B 55-kilodalton protein is phosphorylated by protein kinase CK2. J Virol 2012-03-01 [PMID: 22190719]
• Ducu RI, Dayaram T, Marriott SJ. The HTLV-1 Tax oncoprotein represses Ku80 gene expression. Virology. 2011-07-01 [PMID: 21571351] (WB, Human)
• de Krijger I, Jacobs JJL CHD2 and H3. 3 promote NHEJ at deprotected telomeres Book 2021-01-01 (WB, Mouse)

Bioinformatics

• Gene Symbol: LIG4
• Entrez:
  • 3981(Human)
• Uniprot:
  • P49917(Human)