| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, Mycoplasma |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DNA Ligase IV. Peptide Sequence DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LIG4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in Knockdown Validated reported in scientific literature (PMID:32846126) |
||
| Theoretical MW | 104 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publications using NB110-57379 | Applications | Species |
|---|---|---|
| Francica P, Mutlu M, Blomen VA et al. Functional Radiogenetic Profiling Implicates ERCC6L2 in Non-homologous End Joining Cell Rep 2020-08-25 [PMID: 32846126] (WB, KD, Mouse) | WB, KD | Mouse |
| Ching W, Dobner T, Koyuncu E. The human adenovirus type 5 E1B 55-kilodalton protein is phosphorylated by protein kinase CK2. J Virol 2012-03-01 [PMID: 22190719] | ||
| Ducu RI, Dayaram T, Marriott SJ. The HTLV-1 Tax oncoprotein represses Ku80 gene expression. Virology. 2011-07-01 [PMID: 21571351] (WB, Human) | WB | Human |
| de Krijger I, Jacobs JJL CHD2 and H3. 3 promote NHEJ at deprotected telomeres Book 2021-01-01 (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNA Ligase IV Antibody (NB110-57379)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.