Recombinant Human DMRTA1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DMRTA1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 301-390 of Human DMRTA1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESGNESEWVKDLTSTKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRA

Protein/Peptide Type
Partial Recombinant Protein
Gene
DMRTA1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DMRTA1 Protein

  • DMO
  • DMRT-like family A1
  • doublesex- and mab-3-related transcription factor A1
  • MGC163307
  • MGC163309

Background

DMRTA1 - DMRT-like family A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86361
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
H00058524-R01
Species: Hu
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-48988
Species: Hu
Applications: IHC
AF3075
Species: Hu
Applications: WB, ICC
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-91839
Species: Hu
Applications: IHC, IHC-P
NBP1-86287
Species: Hu
Applications: IHC, IHC-P
H00063951-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DMRTA1 Partial Recombinant Protein (H00063951-Q01) (0)

There are no publications for DMRTA1 Partial Recombinant Protein (H00063951-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMRTA1 Partial Recombinant Protein (H00063951-Q01) (0)

There are no reviews for DMRTA1 Partial Recombinant Protein (H00063951-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DMRTA1 Partial Recombinant Protein (H00063951-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMRTA1 Products

Bioinformatics Tool for DMRTA1 Partial Recombinant Protein (H00063951-Q01)

Discover related pathways, diseases and genes to DMRTA1 Partial Recombinant Protein (H00063951-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DMRTA1

There are no specific blogs for DMRTA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DMRTA1 Antibody
NBP1-91838

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DMRTA1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DMRTA1