DMBT1/GP340 Recombinant Protein Antigen

Images

 
There are currently no images for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DMBT1/GP340 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DMBT1.

Source: E. coli

Amino Acid Sequence: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DMBT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DMBT1/GP340 Recombinant Protein Antigen

  • CRP-ductin
  • deleted in malignant brain tumors 1 protein
  • deleted in malignant brain tumors 1
  • DMBT1
  • Ebnerin
  • FLJ61058
  • Glycoprotein 340
  • GP340
  • gp-340
  • GP340muclin
  • Hensin
  • MGC164738
  • Muclin
  • SAG
  • Salivary agglutinin
  • Surfactant pulmonary-associated D-binding protein
  • Vomeroglandin

Background

Glycoprotein-340 is member of the scavenger receptor superfamily and has been identified as a putative SP-D receptor. Gp-340 has been shown to bind SP-D in a calcium dependent manner through a protein-protein interaction. Like SP-D, gp-340 is mainly found in lung tissue and immunohistochemistry revealed high expression in alveolar macrophages (1). An identical protein is present in saliva (salivary agglutinin) and both forms are encoded by the gene DMBT1 (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85594
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1920
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-92151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-38885
Species: Hu
Applications: IHC,  IHC-P
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
H00009033-M01
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
NBP2-38471PEP
Species: Hu
Applications: AC

Publications for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no publications for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no reviews for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMBT1/GP340 Products

Research Areas for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP)

Find related products by research area.

Blogs on DMBT1/GP340

There are no specific blogs for DMBT1/GP340, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DMBT1/GP340 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DMBT1