Recombinant Human Dlx6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Dlx6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human DLX6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DLX6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dlx6 Protein

  • distal-less homeo box 6
  • distal-less homeobox 6
  • homeobox protein DLX-6
  • MGC125282
  • MGC125283
  • MGC125284
  • MGC125285

Background

DLX6 - distal-less homeo box 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
AF3876
Species: Hu, Mu
Applications: WB, IHC
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-24715
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
H00001750-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Dlx6 Partial Recombinant Protein (H00001750-Q01) (0)

There are no publications for Dlx6 Partial Recombinant Protein (H00001750-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx6 Partial Recombinant Protein (H00001750-Q01) (0)

There are no reviews for Dlx6 Partial Recombinant Protein (H00001750-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dlx6 Partial Recombinant Protein (H00001750-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dlx6 Products

Bioinformatics Tool for Dlx6 Partial Recombinant Protein (H00001750-Q01)

Discover related pathways, diseases and genes to Dlx6 Partial Recombinant Protein (H00001750-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dlx6 Partial Recombinant Protein (H00001750-Q01)

Discover more about diseases related to Dlx6 Partial Recombinant Protein (H00001750-Q01).
 

Pathways for Dlx6 Partial Recombinant Protein (H00001750-Q01)

View related products by pathway.

PTMs for Dlx6 Partial Recombinant Protein (H00001750-Q01)

Learn more about PTMs related to Dlx6 Partial Recombinant Protein (H00001750-Q01).
 

Research Areas for Dlx6 Partial Recombinant Protein (H00001750-Q01)

Find related products by research area.

Blogs on Dlx6

There are no specific blogs for Dlx6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
Dlx6 Antibody
NBP1-85929
BP1 Antibody
NB100-481

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dlx6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX6