Recombinant Human DLX3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DLX3 Protein Summary

Description
DLX3 (Human) GST-Tagged Recombinant Protein (P02)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Protein/Peptide Type
Recombinant Protein
Gene
DLX3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DLX3 Protein

  • AI4
  • distal-less homeo box 3
  • distal-less homeobox 3
  • homeobox protein DLX-3
  • TDO

Background

DLX3( AAH12361, 1 a.a. - 288 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006999-B01P
Species: Hu, Mu
Applications: WB
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00001749-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-45579
Species: Hu
Applications: IHC, IHC-P
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001747-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for DLX3 Recombinant Protein (H00001747-P02) (0)

There are no publications for DLX3 Recombinant Protein (H00001747-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX3 Recombinant Protein (H00001747-P02) (0)

There are no reviews for DLX3 Recombinant Protein (H00001747-P02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLX3 Recombinant Protein (H00001747-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human DLX3 Protein Products

Related Products by Gene

Bioinformatics Tool for DLX3 Recombinant Protein (H00001747-P02)

Discover related pathways, diseases and genes to DLX3 Recombinant Protein (H00001747-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX3 Recombinant Protein (H00001747-P02)

Discover more about diseases related to DLX3 Recombinant Protein (H00001747-P02).
 

Pathways for DLX3 Recombinant Protein (H00001747-P02)

View related products by pathway.

PTMs for DLX3 Recombinant Protein (H00001747-P02)

Learn more about PTMs related to DLX3 Recombinant Protein (H00001747-P02).
 

Research Areas for DLX3 Recombinant Protein (H00001747-P02)

Find related products by research area.

Blogs on DLX3

There are no specific blogs for DLX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DLX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX3

Customers Who Bought This Also Bought

DLX3 Antibody
NBP2-24646
DLX3 Antibody
NBP2-24646