DLX3 Antibody

Images

 
Western Blot: DLX3 Antibody [NBP1-86334] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: DLX3 Antibody [NBP1-86334] - Staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related DLX3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86334
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DLX3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DLX3 Antibody

  • AI4
  • distal-less homeo box 3
  • distal-less homeobox 3
  • homeobox protein DLX-3
  • TDO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45995
Species: Hu
Applications: WB, IHC
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB7389
Species: Mu
Applications: WB, IHC
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86334
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DLX3 Antibody (NBP1-86334) (0)

There are no publications for DLX3 Antibody (NBP1-86334).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX3 Antibody (NBP1-86334) (0)

There are no reviews for DLX3 Antibody (NBP1-86334). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLX3 Antibody (NBP1-86334) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLX3 Products

Bioinformatics Tool for DLX3 Antibody (NBP1-86334)

Discover related pathways, diseases and genes to DLX3 Antibody (NBP1-86334). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX3 Antibody (NBP1-86334)

Discover more about diseases related to DLX3 Antibody (NBP1-86334).
 

Pathways for DLX3 Antibody (NBP1-86334)

View related products by pathway.

PTMs for DLX3 Antibody (NBP1-86334)

Learn more about PTMs related to DLX3 Antibody (NBP1-86334).
 

Research Areas for DLX3 Antibody (NBP1-86334)

Find related products by research area.

Blogs on DLX3

There are no specific blogs for DLX3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX3