DLX3 Antibody

Images

 
Western Blot: DLX3 Antibody [H00001747-D01P] - Analysis of DLX3 expression in mouse brain.
Western Blot: DLX3 Antibody [H00001747-D01P] - Analysis of DLX3 expression in transfected 293T cell line by DLX3 polyclonal antibody.Lane 1: DLX3 transfected lysate(31.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DLX3 Antibody Summary

Immunogen
DLX3 (NP_005211.1, 1 a.a. - 287 a.a.) full-length human protein. MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
Specificity
DLX3 - distal-less homeobox 3,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLX3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DLX3 Antibody

  • AI4
  • distal-less homeo box 3
  • distal-less homeobox 3
  • homeobox protein DLX-3
  • TDO

Background

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45995
Species: Hu
Applications: WB, IHC
NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85793
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
H00001746-M06
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB7389
Species: Mu
Applications: WB, IHC
H00001745-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-85929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001747-D01P
Species: Hu, Mu
Applications: WB

Publications for DLX3 Antibody (H00001747-D01P) (0)

There are no publications for DLX3 Antibody (H00001747-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLX3 Antibody (H00001747-D01P) (0)

There are no reviews for DLX3 Antibody (H00001747-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLX3 Antibody (H00001747-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLX3 Products

Bioinformatics Tool for DLX3 Antibody (H00001747-D01P)

Discover related pathways, diseases and genes to DLX3 Antibody (H00001747-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLX3 Antibody (H00001747-D01P)

Discover more about diseases related to DLX3 Antibody (H00001747-D01P).
 

Pathways for DLX3 Antibody (H00001747-D01P)

View related products by pathway.

PTMs for DLX3 Antibody (H00001747-D01P)

Learn more about PTMs related to DLX3 Antibody (H00001747-D01P).
 

Research Areas for DLX3 Antibody (H00001747-D01P)

Find related products by research area.

Blogs on DLX3

There are no specific blogs for DLX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLX3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLX3
Entrez
Uniprot