DLL4 Antibody

Images

 
Western Blot: DLL4 Antibody [NBP1-59702] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DLL4 Antibody Summary

Immunogen
Synthetic peptides corresponding to DLL4(delta-like 4 (Drosophila)) The peptide sequence was selected from the N terminal of DLL4. Peptide sequence QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DLL4 and was validated on Western blot.
Theoretical MW
72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-59702.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DLL4 Antibody

  • Delta 4 precursor
  • delta 4
  • delta ligand 4
  • delta4
  • delta-like 4 (Drosophila)
  • delta-like 4 homolog (Drosophila)
  • delta-like 4 homolog
  • delta-like 4 protein
  • delta-like protein 4
  • DLL4
  • Drosophila Delta homolog 4
  • hdelta2
  • MGC126344
  • notch ligand delta-2
  • notch ligand DLL4

Background

Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00004854-M01
Species: Hu
Applications: WB, ELISA
NBP2-27152
Species: Mu
Applications: WB
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-57809
Species: Hu
Applications: ICC/IF
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP1-59702
Species: Hu
Applications: WB

Publications for DLL4 Antibody (NBP1-59702)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DLL4 Antibody (NBP1-59702) (0)

There are no reviews for DLL4 Antibody (NBP1-59702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLL4 Antibody (NBP1-59702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLL4 Products

Bioinformatics Tool for DLL4 Antibody (NBP1-59702)

Discover related pathways, diseases and genes to DLL4 Antibody (NBP1-59702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLL4 Antibody (NBP1-59702)

Discover more about diseases related to DLL4 Antibody (NBP1-59702).
 

Pathways for DLL4 Antibody (NBP1-59702)

View related products by pathway.

PTMs for DLL4 Antibody (NBP1-59702)

Learn more about PTMs related to DLL4 Antibody (NBP1-59702).

Blogs on DLL4.

New DLL4 Vaccine May Prevent Breast Tumors
We at Novus Biologicals have a large antibody database devoted to signalling pathways. These underpin every area of molecular biological research, including cancer. Among our cell signalling antibodies is one targeted to DLL4 (Delta-like protein 4). D...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLL4
Entrez
Uniprot