DLL3 Antibody


Western Blot: DLL3 Antibody [NBP1-69268] - This Anti-DLL3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DLL3 Antibody Summary

Synthetic peptides corresponding to DLL3(delta-like 3 (Drosophila)) The peptide sequence was selected from the N terminal of DLL3 (NP_058637). Peptide sequence MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DLL3 Antibody

  • delta (Drosophila)-like 3
  • Delta3
  • delta-like 3 (Drosophila)
  • delta-like protein 3
  • DLL3
  • Drosophila Delta homolog 3
  • Pudgy
  • SCDO1
  • SCDO1delta3


DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1. Two transcript variants encoding distinct isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Mu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P

Publications for DLL3 Antibody (NBP1-69268) (0)

There are no publications for DLL3 Antibody (NBP1-69268).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLL3 Antibody (NBP1-69268) (0)

There are no reviews for DLL3 Antibody (NBP1-69268). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLL3 Antibody (NBP1-69268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DLL3 Products

Bioinformatics Tool for DLL3 Antibody (NBP1-69268)

Discover related pathways, diseases and genes to DLL3 Antibody (NBP1-69268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLL3 Antibody (NBP1-69268)

Discover more about diseases related to DLL3 Antibody (NBP1-69268).

Pathways for DLL3 Antibody (NBP1-69268)

View related products by pathway.

PTMs for DLL3 Antibody (NBP1-69268)

Learn more about PTMs related to DLL3 Antibody (NBP1-69268).

Blogs on DLL3

There are no specific blogs for DLL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DLL3 Antibody and receive a gift card or discount.


Gene Symbol DLL3