DLC1 Antibody

Images

 
Western Blot: DLC1 Antibody [NBP1-52838] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related DLC1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52838
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DLC1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DLC1(deleted in liver cancer 1) The peptide sequence was selected from the C terminal of DLC1. Peptide sequence NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL.
Clonality
Polyclonal
Host
Rabbit
Gene
DLC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DLC1 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DLC1 Antibody

  • ARHGAP7 STARD12 deleted in liver cancer 1 variant 2
  • Deleted in liver cancer 1 protein
  • deleted in liver cancer 1
  • DLC-1
  • FLJ21120
  • HP protein
  • HP
  • KIAA1723
  • p122-RhoGAP
  • rho GTPase-activating protein 7
  • Rho-GTPase-activating protein 7
  • Rho-type GTPase-activating protein 7
  • StARD12
  • StAR-related lipid transfer (START) domain containing 12
  • StAR-related lipid transfer protein 12
  • START domain-containing protein 12

Background

This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-12553
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52838
Species: Hu
Applications: WB

Publications for DLC1 Antibody (NBP1-52838) (0)

There are no publications for DLC1 Antibody (NBP1-52838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLC1 Antibody (NBP1-52838) (0)

There are no reviews for DLC1 Antibody (NBP1-52838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLC1 Antibody (NBP1-52838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DLC1 Products

Bioinformatics Tool for DLC1 Antibody (NBP1-52838)

Discover related pathways, diseases and genes to DLC1 Antibody (NBP1-52838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLC1 Antibody (NBP1-52838)

Discover more about diseases related to DLC1 Antibody (NBP1-52838).
 

Pathways for DLC1 Antibody (NBP1-52838)

View related products by pathway.

PTMs for DLC1 Antibody (NBP1-52838)

Learn more about PTMs related to DLC1 Antibody (NBP1-52838).

Blogs on DLC1

There are no specific blogs for DLC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DLC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLC1
Uniprot