DLC1 Antibody


Western Blot: DLC1 Antibody [NBP1-52838] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related DLC1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DLC1 Antibody Summary

Synthetic peptides corresponding to DLC1(deleted in liver cancer 1) The peptide sequence was selected from the C terminal of DLC1. Peptide sequence NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against DLC1 and was validated on Western blot.
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DLC1 Antibody

  • ARHGAP7 STARD12 deleted in liver cancer 1 variant 2
  • Deleted in liver cancer 1 protein
  • deleted in liver cancer 1
  • DLC-1
  • FLJ21120
  • HP protein
  • HP
  • KIAA1723
  • p122-RhoGAP
  • rho GTPase-activating protein 7
  • Rho-GTPase-activating protein 7
  • Rho-type GTPase-activating protein 7
  • StARD12
  • StAR-related lipid transfer (START) domain containing 12
  • StAR-related lipid transfer protein 12
  • START domain-containing protein 12


This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for DLC1 Antibody (NBP1-52838) (0)

There are no publications for DLC1 Antibody (NBP1-52838).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DLC1 Antibody (NBP1-52838) (0)

There are no reviews for DLC1 Antibody (NBP1-52838). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DLC1 Antibody (NBP1-52838) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DLC1 Products

Bioinformatics Tool for DLC1 Antibody (NBP1-52838)

Discover related pathways, diseases and genes to DLC1 Antibody (NBP1-52838). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DLC1 Antibody (NBP1-52838)

Discover more about diseases related to DLC1 Antibody (NBP1-52838).

Pathways for DLC1 Antibody (NBP1-52838)

View related products by pathway.

PTMs for DLC1 Antibody (NBP1-52838)

Learn more about PTMs related to DLC1 Antibody (NBP1-52838).

Blogs on DLC1

There are no specific blogs for DLC1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DLC1 Antibody and receive a gift card or discount.


Gene Symbol DLC1