Home » Dkk-1 » Dkk-1 Antibodies » Dkk-1 Antibody (NBP1-59321)

Dkk-1 Antibody (NBP1-59321)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Dkk-1 Antibody [NBP1-59321] - HepG2 cell lysate, concentration 2.5 ug/ml.
Western Blot: Dkk-1 Antibody [NBP1-59321] - HepG2 cell lysate, concentration 2.5 ug/ml.
Western Blot: Dkk-1 Antibody [NBP1-59321] - Lanes: Lane 1 : 30ug human PLC/PRF5 cell lysate Lane 2: 30ug DKK1 PLC/PRF5 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Dkk-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DKK1(dickkopf homolog 1 (Xenopus laevis)) The peptide sequence was selected from the C terminal of DKK1. Peptide sequence CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DKK1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DKK1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dkk-1 Antibody

  • dickkopf (Xenopus laevis) homolog 1
  • dickkopf homolog 1 (Xenopus laevis)
  • dickkopf related protein-1
  • Dickkopf-1
  • dickkopf-related protein 1
  • Dkk1
  • Dkk-1
  • hDkk-1
  • SKdickkopf-1 like

Background

DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot (Negative): beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
LRP-5 Antibody
NB100-1886
Western Blot: LRP-5 Antibody [NB100-1886] - (1ug/ml) staining of HepG2 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: LRP-5 Antibody [NB100-1886] - (2ug/ml) staining of paraffin embedded Human Liver. Steamed antigen retrieval with citrate buffer pH 6, HRP-staining.
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Osteoprotegerin/TNFRSF ...
NB100-56505
Western Blot: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - Analysis of Daudi lysate using the OPG antibody at 1 ug/ml.
Immunohistochemistry-Paraffin: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - Staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Flow Cytometry: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - Intracellular staining of 10^6 HeLa cells using 0.2 ug of OPG antibody, 0.5 ul of PE secondary.
(25 Publications)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
SOST/Sclerostin
Antibody [Unconjugate
AF1589
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (kidney) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to glomeruli. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of human bone marrow and mouse bone marrow. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOST/Sclerostin at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (adrenal gland) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(24 Publications)
Species: Mu
Applications: WB, IHC
LRP-6 Antibody
AF1505
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with human LRP‑6. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human LRP‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1505) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for LRP‑6 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
Wnt3 Antibody
NB100-40793
Western Blot: Wnt3 Antibody [NB100-40793] - (1ug/ml) staining of lysate of cell line HEK293 (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Wnt3 Antibody [NB100-40793] - (3.8ug/ml) staining of paraffin embedded Human Breast. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: Wnt3 Antibody [NB100-40793] - (2ug/ml) staining of paraffin embedded Human Breast. Steamed antigen retrieval with citrate buffer pH 6, HRP-staining.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Dkk-2 Antibody
AF2435
Dkk‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using 15 µg/mL Mouse Dkk‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2435) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
Dkk-3 Antibody
[Unconjugated]
AF1118
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Dkk‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1118) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Dkk‑3 at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(8 Publications)
Species: Hu
Applications: WB, IHC
HNF-4 alpha/NR2A1
Antibody (843716) [Un ...
MAB4605
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. Gels were loaded with 10 µg of cytoplasmic (Cyto) and 5 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human HNF‑4 alpha /NR2A1 Monoclonal Antibody (Catalog # MAB4605) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for HNF‑4 alpha /NR2A1 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HNF‑4 alpha /NR2A1 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human HNF‑4 alpha /NR2A1 Monoclonal Antibody (Catalog # MAB4605) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human HNF-4 alpha/NR2A1 Monoclonal Antibody (Catalog # MAB4605, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram) followed by PE-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3/Transcription Factor Fixation & Permeabilization Buffer Kit (Catalog # FC012). View our protocol for Staining Intracellular Molecules.
(1 Review)
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot (Negative): beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
GSK-3 beta
Antibody (3D10)
NBP1-47470
Western Blot: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of GSK-3 beta in mouse beta cell line (betaTC3) using anti-GSK-3 beta antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of NIH/3T3 (left) and U251 (right) cells using GSK3 beta mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: GSK-3 beta Antibody (3D10) [NBP1-47470] - Immunohistochemical analysis of paraffin-embedded human lung cancer (left) and breast cancer tissues (right) using GSK3 beta mouse mAb with DAB staining.
(3 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Osteocalcin
Antibody (190125)
MAB1419
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(14 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow

Publications for Dkk-1 Antibody (NBP1-59321) (0)

There are no publications for Dkk-1 Antibody (NBP1-59321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dkk-1 Antibody (NBP1-59321) (0)

There are no reviews for Dkk-1 Antibody (NBP1-59321). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dkk-1 Antibody (NBP1-59321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dkk-1 Antibody Products

Related Products by Gene

BETA-CATENIN, BGLAP, BMP4, BTF3P11, CTNNB1, DICKKOPF-1, DKK2, DKK3, GSK3B, HNF4A, LRP5, LRP6, SFRP1, SOST, TNF, TNFRSF11B, TNFSF11, WNT, WNT3, WNT3A

Bioinformatics Tool for Dkk-1 Antibody (NBP1-59321)

Discover related pathways, diseases and genes to Dkk-1 Antibody (NBP1-59321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dkk-1 Antibody (NBP1-59321)

Discover more about diseases related to Dkk-1 Antibody (NBP1-59321).
 

Pathways for Dkk-1 Antibody (NBP1-59321)

View related products by pathway.

PTMs for Dkk-1 Antibody (NBP1-59321)

Learn more about PTMs related to Dkk-1 Antibody (NBP1-59321).
 

Research Areas for Dkk-1 Antibody (NBP1-59321)

Find related products by research area.

Blogs on Dkk-1

There are no specific blogs for Dkk-1, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dkk-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DKK1
Entrez
Uniprot

Customers Who Bought This Also Bought