Home » Dkk-1 » Dkk-1 Antibodies » Dkk-1 Antibody

Dkk-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Dkk-1 Antibody [NBP1-59321] - HepG2 cell lysate, concentration 2.5 ug/ml.
Western Blot: Dkk-1 Antibody [NBP1-59321] - HepG2 cell lysate, concentration 2.5 ug/ml.
Western Blot: Dkk-1 Antibody [NBP1-59321] - Lanes: Lane 1 : 30ug human PLC/PRF5 cell lysate Lane 2: 30ug DKK1 PLC/PRF5 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Dkk-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DKK1(dickkopf homolog 1 (Xenopus laevis)) The peptide sequence was selected from the C terminal of DKK1. Peptide sequence CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DKK1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DKK1 and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Dkk-1 Lysate (NBP2-64918)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dkk-1 Antibody

  • dickkopf (Xenopus laevis) homolog 1
  • dickkopf homolog 1 (Xenopus laevis)
  • dickkopf related protein-1
  • Dickkopf-1
  • dickkopf-related protein 1
  • Dkk1
  • Dkk-1
  • hDkk-1
  • SKdickkopf-1 like

Background

DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
LRP-5 Antibody
NB100-1886
Western Blot: LRP-5 Antibody [NB100-1886] - (1ug/ml) staining of HepG2 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: LRP-5 Antibody [NB100-1886] - (2ug/ml) staining of paraffin embedded Human Liver. Steamed antigen retrieval with citrate buffer pH 6, HRP-staining.
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Osteoprotegerin/TNFRSF ...
NB100-56505
Immunohistochemistry-Paraffin: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - IHC analysis of a formalin fixed paraffin embedded tissue section of human liver using 1:200 dilution of anti-Osteoprotegerin/TNFRSF11B antibody (clone 98A1071). The staining was developed with HRP labeled secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Osteoprotegerin antibody generated a diffused but weak cytoplasmic staining with a very specific and strong punctate signal at the periphery of the cells.
Western Blot: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - Total protein from human MG63 and Daudi cell lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Osteoprotegerin in blocking buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: Osteoprotegerin/TNFRSF11B Antibody (98A1071) [NB100-56505] - MG-63 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Osteoprotegerin (98A1071) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(27 Publications)
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Wnt-3a
[Unconjugated]
5036-WN
Wnt-3a [Unconjugated]
(11 Reviews)
(133 Publications)
Species: Hu
SOST/Sclerostin
Antibody [Unconjugate
AF1589
Western blot shows lysates of human bone marrow and mouse bone marrow. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOST/Sclerostin at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (adrenal gland) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
SOST/Sclerostin was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse SOST/Sclerostin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1589) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(3 Reviews)
(26 Publications)
Species: Mu
Applications: WB, IHC
LRP-6 Antibody
AF1505
Western blot shows lysates of 293T human embryonic kidney cell line either mock transfected or transfected with human LRP‑6. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human LRP‑6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1505) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for LRP‑6 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
sFRP-1 Antibody
[Unconjugated]
AF1384
sFRP‑1 was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human sFRP‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1384) at 1 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cell cytoplasm in convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
sFRP‑1 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human sFRP‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1384) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(5 Publications)
Species: Hu
Applications: WB, IHC, ICC

TRANCE/TNFSF11/RANK L
462-TR
1 μg/lane of Recombinant Mouse TRANCE/TNFSF11/RANK L was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 36 kDa.
Recombinant Mouse TRANCE/TNFSF11/RANK L (Catalog # 462-TR) induces osteoclast differentiation of the RAW 264.7 mouse monocyte/macrophage cell line. The ED50 for this effect is 5‑15 ng/mL in the presence of 2.5 μg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody (Catalog # MAB050)
(51 Publications)
Species: Mu
Wnt3 Antibody
(OTI1G7)
NBP2-46367
Western Blot: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY WNT3.
Immunohistochemistry: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: Wnt3 Antibody (1G7) [NBP2-46367] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: WB, IHC
Dkk-2 Antibody
AF2435
Dkk‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using 15 µg/mL Mouse Dkk‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2435) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Review)
(2 Publications)
Species: Mu
Applications: WB, IHC
Dkk-3 Antibody
[Unconjugated]
AF1118
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Dkk‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1118) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Dkk‑3 at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(8 Publications)
Species: Hu
Applications: WB, IHC
HNF-4 alpha/NR2A1
Antibody
NBP1-89679
Western Blot: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Analysis in human cell lines Caco-2 and PC-3 using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HNF-4 alpha/NR2A1 Antibody [NBP1-89679] - Staining in human duodenum and tonsil tissues using anti-HNF4A antibody. Corresponding HNF4A RNA-seq data are presented for the same tissues.
(4 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BMP-4
[Unconjugated]
314-BP
1 ug/lane of Recombinant Human BMP-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 22-25 kDa and 37-41 kDa, respectively. Multiple bands in gel are due to variable glycosylation. 
Recombinant Human BMP-4 (Catalog #314-BP/CF) induces alkaline phosphatase production in the ATDC5 mouse chondrogenic cell line. The ED50 for this effect is 2.5-15 ng/mL.
(3 Reviews)
(257 Publications)
Species: Hu
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
GSK-3 beta
Antibody (3D10)
NBP1-47470
Western Blot: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of GSK-3 beta in mouse beta cell line (betaTC3) using anti-GSK-3 beta antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: GSK-3 beta Antibody (3D10) [NBP1-47470] - Analysis of NIH/3T3 (left) and U251 (right) cells using GSK3 beta mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: GSK-3 beta Antibody (3D10) [NBP1-47470] - Immunohistochemical analysis of paraffin-embedded human lung cancer (left) and breast cancer tissues (right) using GSK3 beta mouse mAb with DAB staining.
(3 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Osteocalcin
Antibody (190125)
MAB1419
Osteocalcin was detected in immersion fixed paraffin-embedded sections of human osteosarcoma using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 25 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Osteocalcin was detected in immersion fixed MG‑63 human osteosarcoma cell line using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteocalcin was detected in immersion fixed rat osteocytes differentiated from mesenchymal stem cells using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(18 Publications)
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
TNF-alpha
[Unconjugated]
210-TA/CF
Recombinant Human TNF-alpha (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(478 Publications)
Species: Hu
Dkk-1 Antibody
NBP1-59321
Dkk-1 Antibody
Species: Hu
Applications: WB

Publications for Dkk-1 Antibody (NBP1-59321) (0)

There are no publications for Dkk-1 Antibody (NBP1-59321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dkk-1 Antibody (NBP1-59321) (0)

There are no reviews for Dkk-1 Antibody (NBP1-59321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dkk-1 Antibody (NBP1-59321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Dkk-1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Dkk-1 Products

Bioinformatics Tool for Dkk-1 Antibody (NBP1-59321)

Discover related pathways, diseases and genes to Dkk-1 Antibody (NBP1-59321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dkk-1 Antibody (NBP1-59321)

Discover more about diseases related to Dkk-1 Antibody (NBP1-59321).
 

Pathways for Dkk-1 Antibody (NBP1-59321)

View related products by pathway.

PTMs for Dkk-1 Antibody (NBP1-59321)

Learn more about PTMs related to Dkk-1 Antibody (NBP1-59321).
 

Research Areas for Dkk-1 Antibody (NBP1-59321)

Find related products by research area.

Blogs on Dkk-1

There are no specific blogs for Dkk-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dkk-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DKK1
Entrez
Uniprot