Dkk-1 Antibody Summary
Immunogen |
Synthetic peptides corresponding to DKK1(dickkopf homolog 1 (Xenopus laevis)) The peptide sequence was selected from the C terminal of DKK1. Peptide sequence CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DKK1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
|
Application Notes |
This is a rabbit polyclonal antibody against DKK1 and was validated on Western blot. |
Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Positive Control |
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Protein A purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Dkk-1 Antibody
Background
DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB
Publications for Dkk-1 Antibody (NBP1-59321) (0)
There are no publications for Dkk-1 Antibody (NBP1-59321).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dkk-1 Antibody (NBP1-59321) (0)
There are no reviews for Dkk-1 Antibody (NBP1-59321).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Dkk-1 Antibody (NBP1-59321) (0)
Positive Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Additional Dkk-1 Products
Bioinformatics Tool for Dkk-1 Antibody (NBP1-59321)
Discover related pathways, diseases and genes to Dkk-1 Antibody (NBP1-59321). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Dkk-1 Antibody (NBP1-59321)
Discover more about diseases related to Dkk-1 Antibody (NBP1-59321).
| | Pathways for Dkk-1 Antibody (NBP1-59321)
View related products by pathway.
|
PTMs for Dkk-1 Antibody (NBP1-59321)
Learn more about PTMs related to Dkk-1 Antibody (NBP1-59321).
| | Research Areas for Dkk-1 Antibody (NBP1-59321)
Find related products by research area.
|
Blogs on Dkk-1