Dkk-1 Antibody

Images

 
Western Blot: Dkk-1 Antibody [NBP1-59321] - HepG2 cell lysate, concentration 2.5 ug/ml.
Western Blot: Dkk-1 Antibody [NBP1-59321] - Lanes: Lane 1 : 30ug human PLC/PRF5 cell lysate Lane 2: 30ug DKK1 PLC/PRF5 cell lysate Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Anti-rabbit-HRP ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

Dkk-1 Antibody Summary

Immunogen
Synthetic peptides corresponding to DKK1(dickkopf homolog 1 (Xenopus laevis)) The peptide sequence was selected from the C terminal of DKK1. Peptide sequence CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD.
Clonality
Polyclonal
Host
Rabbit
Gene
DKK1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DKK1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dkk-1 Antibody

  • dickkopf (Xenopus laevis) homolog 1
  • dickkopf homolog 1 (Xenopus laevis)
  • dickkopf related protein-1
  • Dickkopf-1
  • dickkopf-related protein 1
  • Dkk1
  • Dkk-1
  • hDkk-1
  • SKdickkopf-1 like

Background

DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF6646
Species: Hu
Applications: WB
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-40793
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF2435
Species: Mu
Applications: WB, IHC
AF1118
Species: Hu
Applications: WB, IHC
PP-H1415-00
Species: Hu
Applications: WB, IHC, IP, ChIP, DirELISA, GS
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB8934
Species: Hu
Applications: WB, Simple Western, ICC
MAB1419
Species: Hu, Rt
Applications: IHC, ICC, ICFlow
NBP1-59321
Species: Hu
Applications: WB

Publications for Dkk-1 Antibody (NBP1-59321) (0)

There are no publications for Dkk-1 Antibody (NBP1-59321).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dkk-1 Antibody (NBP1-59321) (0)

There are no reviews for Dkk-1 Antibody (NBP1-59321). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dkk-1 Antibody (NBP1-59321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dkk-1 Antibody Products

Related Products by Gene

Bioinformatics Tool for Dkk-1 Antibody (NBP1-59321)

Discover related pathways, diseases and genes to Dkk-1 Antibody (NBP1-59321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dkk-1 Antibody (NBP1-59321)

Discover more about diseases related to Dkk-1 Antibody (NBP1-59321).
 

Pathways for Dkk-1 Antibody (NBP1-59321)

View related products by pathway.

PTMs for Dkk-1 Antibody (NBP1-59321)

Learn more about PTMs related to Dkk-1 Antibody (NBP1-59321).
 

Research Areas for Dkk-1 Antibody (NBP1-59321)

Find related products by research area.

Blogs on Dkk-1

There are no specific blogs for Dkk-1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol DKK1
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59321 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought