Recombinant Human DIO3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DIO3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-143 of Human DIO3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DIO3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DIO3 Protein

  • 5DIII
  • D3
  • deiodinase, iodothyronine, type III
  • DIOIII
  • EC 1.97.1
  • EC 1.97.1.11
  • ITDI3
  • placental type
  • thyroxine deiodinase type III (selenoprotein)
  • Type 3 DI
  • type 3 iodothyronine selenodeiodinase
  • type III iodothyronine deiodinase
  • type-III 5' deiodinase
  • Type-III 5'-deiodinase

Background

DIO3( AAH17717, 1 a.a. - 144 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP1-02398
Species: Hu, Mk
Applications: ELISA, IHC, IHC-P
NBP2-35213
Species: Hu
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
H00001815-R02
Species: Hu
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DIO3 Recombinant Protein (H00001735-P01) (0)

There are no publications for DIO3 Recombinant Protein (H00001735-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIO3 Recombinant Protein (H00001735-P01) (0)

There are no reviews for DIO3 Recombinant Protein (H00001735-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIO3 Recombinant Protein (H00001735-P01). (Showing 1 - 2 of 2 FAQ).

  1. I am looking for a Dio3 peptide that I can inject in vivo to produce a biological effect. Can you provide information or confirm whether the Dio3 peptide you have would be effective as a biological agent in vivo?
    • I have pulled up information on the Dio3 peptides and recombinant proteins that we have available. Unfortunately I would not expect any of them to be biologically active and capable of producing a response when injected in vivo. The two peptides we carry are simply intended to be used for negative control competition assays to block signal of the primary and determine what is specific and non-specific as far as signal is concerned. The other two recombinant proteins are ones we distribute for a Taiwanese company called Abnova and they should not be biologically active based on the cell free wheat germ system employed to synthesize them. We will typically list our active proteins with an indication of such on our datasheet if it has been tested and usually the application of functional listed.
  2. I recently purchased the DIO3 antibody (NBP1-19747) and I am looking for a positive control for western blotting.
    • H00001735-P01 is a protein produced by a Taiwanese company called Abnova and we distribute it for them. It is generally intended to be used with their antibodies. NBP2-04196 is a better choice for use with NBP1-19747.

Additional DIO3 Products

Bioinformatics Tool for DIO3 Recombinant Protein (H00001735-P01)

Discover related pathways, diseases and genes to DIO3 Recombinant Protein (H00001735-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIO3 Recombinant Protein (H00001735-P01)

Discover more about diseases related to DIO3 Recombinant Protein (H00001735-P01).
 

Pathways for DIO3 Recombinant Protein (H00001735-P01)

View related products by pathway.

PTMs for DIO3 Recombinant Protein (H00001735-P01)

Learn more about PTMs related to DIO3 Recombinant Protein (H00001735-P01).

Blogs on DIO3

There are no specific blogs for DIO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DIO3 Blocking Peptide
NBP1-05767PEP
DIO3 Antibody
NBP1-05767

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DIO3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DIO3