Dihydrolipoamide Dehydrogenase/DLD Antibody


Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate DLD is supported by BioGPS gene expression data to ...read more
Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies and ...read more
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml DLD is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Sample Type: MCF7 Antibody Dilution: 1.0 ug/ml DLD is supported by BioGPS gene expression data to be expressed in MCF7
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP1-54695] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Dihydrolipoamide Dehydrogenase/DLD Antibody Summary

Synthetic peptides corresponding to DLD(dihydrolipoamide dehydrogenase) The peptide sequence was selected from the middle region of DLD. Peptide sequence AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against DLD and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dihydrolipoamide Dehydrogenase/DLD Antibody

  • 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex)
  • branched chain keto acid dehydrogenase complex
  • Diaphorase
  • dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex
  • Dihydrolipoamide Dehydrogenase
  • dihydrolipoamide dehydrogenasemitochondrial
  • DLD
  • DLDD
  • DLDH
  • E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex
  • E3
  • EC 1.8.1
  • EC
  • GCSL
  • Glycine cleavage system L protein
  • glycine cleavage system protein L
  • LAD
  • Lipoamide Dehydrogenase
  • lipoamide reductase
  • lipoyl dehydrogenase
  • PHE3


DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.This gene encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695) (0)

There are no publications for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695) (0)

There are no reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Bioinformatics Tool for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695)

Discover related pathways, diseases and genes to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695)

Discover more about diseases related to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695).

Pathways for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695)

View related products by pathway.

PTMs for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695)

Learn more about PTMs related to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP1-54695).

Blogs on Dihydrolipoamide Dehydrogenase/DLD

There are no specific blogs for Dihydrolipoamide Dehydrogenase/DLD, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Dihydrolipoamide Dehydrogenase/DLD Antibody and receive a gift card or discount.


Gene Symbol DLD