DIAPH3 Antibody


Western Blot: DIAPH3 Antibody [NBP1-89099] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: DIAPH3 Antibody [NBP1-89099] - Staining of human kidney shows strong cytoplasmic positivity, with a granular pattern in cells in tubules.
Western Blot: DIAPH3 Antibody [NBP1-89099] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Product Discontinued
View other related DIAPH3 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DIAPH3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:PPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
136 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DIAPH3 Antibody

  • DIAP3
  • diaphanous homolog 3 (Drosophila)
  • diaphanous-related formin 3
  • DKFZp434C0931
  • DKFZp686A13178
  • homolog) 3
  • mDia2
  • protein diaphanous homolog 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Bv, Ca, Eq
Applications: WB

Publications for DIAPH3 Antibody (NBP1-89099) (0)

There are no publications for DIAPH3 Antibody (NBP1-89099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIAPH3 Antibody (NBP1-89099) (0)

There are no reviews for DIAPH3 Antibody (NBP1-89099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DIAPH3 Antibody (NBP1-89099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DIAPH3 Products

Bioinformatics Tool for DIAPH3 Antibody (NBP1-89099)

Discover related pathways, diseases and genes to DIAPH3 Antibody (NBP1-89099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH3 Antibody (NBP1-89099)

Discover more about diseases related to DIAPH3 Antibody (NBP1-89099).

Pathways for DIAPH3 Antibody (NBP1-89099)

View related products by pathway.

PTMs for DIAPH3 Antibody (NBP1-89099)

Learn more about PTMs related to DIAPH3 Antibody (NBP1-89099).

Research Areas for DIAPH3 Antibody (NBP1-89099)

Find related products by research area.

Blogs on DIAPH3

There are no specific blogs for DIAPH3, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DIAPH3 Antibody and receive a gift card or discount.


Gene Symbol DIAPH3