DIA1 Antibody

Images

 
Immunohistochemistry-Paraffin: DIA1 Antibody [NBP2-14667] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: DIA1 Antibody [NBP2-14667] - Staining of human gallbladder shows dot-like cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DIA1 Antibody [NBP2-14667] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DIA1 Antibody [NBP2-14667] - Staining of human heart shows moderate granular cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: DIA1 Antibody [NBP2-14667] - Staining of human placenta shows moderate to strong granular cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related DIA1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14667
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DIA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRDGKVIIVDAENVL VADKRLIRQNKPENWDVWYESKFDDCDKE
Specificity
Specificity of human DIA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C3orf58
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIA1 Antibody

  • C3orf58
  • chromosome 3 open reading frame 58
  • DIA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-94010
Species: Hu
Applications: IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59901
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14667
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for DIA1 Antibody (NBP2-14667) (0)

There are no publications for DIA1 Antibody (NBP2-14667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DIA1 Antibody (NBP2-14667) (0)

There are no reviews for DIA1 Antibody (NBP2-14667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DIA1 Antibody (NBP2-14667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for DIA1 Antibody (NBP2-14667)

Discover related pathways, diseases and genes to DIA1 Antibody (NBP2-14667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIA1 Antibody (NBP2-14667)

Discover more about diseases related to DIA1 Antibody (NBP2-14667).
 

Pathways for DIA1 Antibody (NBP2-14667)

View related products by pathway.

Blogs on DIA1

There are no specific blogs for DIA1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C3orf58