DHX58 Antibody

Images

 
Western Blot: DHX58 Antibody [NBP1-57265] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related DHX58 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57265
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DHX58 Antibody Summary

Immunogen
Synthetic peptides corresponding to DHX58(DEXH (Asp-Glu-X-His) box polypeptide 58) The peptide sequence was selected from the N terminal of DHX58. Peptide sequence AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM.
Clonality
Polyclonal
Host
Rabbit
Gene
DHX58
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DHX58 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DHX58 Antibody

  • D11lgp2e
  • D11LGP2probable ATP-dependent RNA helicase DHX58
  • DEXH (Asp-Glu-X-His) box polypeptide 58
  • EC 3.6.4.13
  • LGP2ortholog of mouse D11lgp2
  • Probable ATP-dependent helicase LGP2
  • Protein D11Lgp2 homolog
  • RIG-I-like receptor LGP2
  • RLR
  • RNA helicase LGP2

Background

DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling. Binds dsRNA produced during viral replication, in particuliar HCV RNA. Bin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27419
Species: Hu, Pm
Applications: WB, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Single Cell Western
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
AF6139
Species: Hu
Applications: ICC
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-65021
Species: Hu
NBP1-57265
Species: Hu
Applications: WB

Publications for DHX58 Antibody (NBP1-57265) (0)

There are no publications for DHX58 Antibody (NBP1-57265).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX58 Antibody (NBP1-57265) (0)

There are no reviews for DHX58 Antibody (NBP1-57265). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX58 Antibody (NBP1-57265) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DHX58 Antibody (NBP1-57265)

Discover related pathways, diseases and genes to DHX58 Antibody (NBP1-57265). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX58 Antibody (NBP1-57265)

Discover more about diseases related to DHX58 Antibody (NBP1-57265).
 

Pathways for DHX58 Antibody (NBP1-57265)

View related products by pathway.

PTMs for DHX58 Antibody (NBP1-57265)

Learn more about PTMs related to DHX58 Antibody (NBP1-57265).

Blogs on DHX58

There are no specific blogs for DHX58, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX58 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX58
Uniprot