DHX37 Antibody

Images

 
Western Blot: DHX37 Antibody [NBP1-57290] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related DHX37 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57290
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DHX37 Antibody Summary

Immunogen
Synthetic peptides corresponding to DHX37(DEAH (Asp-Glu-Ala-His) box polypeptide 37) The peptide sequence was selected from the N terminal of DHX37. Peptide sequence PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQASEAEMRLFYTTSKLG.
Clonality
Polyclonal
Host
Rabbit
Gene
DHX37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DHX37 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DHX37 Antibody

  • DDX37
  • DEAD/DEAH box helicase DDX37
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 37
  • DEAH (Asp-Glu-Ala-His) box polypeptide 37
  • DEAH box protein 37
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ41974
  • KIAA1517MGC46245
  • MGC2695
  • MGC4322
  • probable ATP-dependent RNA helicase DHX37

Background

DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DHX37 Antibody (NBP1-57290) (0)

There are no publications for DHX37 Antibody (NBP1-57290).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX37 Antibody (NBP1-57290) (0)

There are no reviews for DHX37 Antibody (NBP1-57290). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX37 Antibody (NBP1-57290) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHX37 Products

Bioinformatics Tool for DHX37 Antibody (NBP1-57290)

Discover related pathways, diseases and genes to DHX37 Antibody (NBP1-57290). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DHX37

There are no specific blogs for DHX37, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHX37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHX37
Uniprot