DHX29 Antibody


Western Blot: DHX29 Antibody [NBP1-85272] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DHX29 Antibody [NBP1-85272] - Staining of human prostate shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DHX29 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFEEQQPKSRPKFQSPQIQATISPPLQPKTK
Specificity of human DHX29 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DHX29 Protein (NBP1-85272PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DHX29 Antibody

  • ATP-dependent RNA helicase DHX29
  • DDX29
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 29
  • DEAH (Asp-Glu-Ala-His) box polypeptide 29
  • DEAH box protein 29
  • EC 3.6.1
  • EC
  • FLJ21492
  • Nucleic acid helicase DDXx


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Po
Applications: WB, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for DHX29 Antibody (NBP1-85272) (0)

There are no publications for DHX29 Antibody (NBP1-85272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHX29 Antibody (NBP1-85272) (0)

There are no reviews for DHX29 Antibody (NBP1-85272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHX29 Antibody (NBP1-85272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DHX29 Products

Bioinformatics Tool for DHX29 Antibody (NBP1-85272)

Discover related pathways, diseases and genes to DHX29 Antibody (NBP1-85272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHX29 Antibody (NBP1-85272)

Discover more about diseases related to DHX29 Antibody (NBP1-85272).

Pathways for DHX29 Antibody (NBP1-85272)

View related products by pathway.

Research Areas for DHX29 Antibody (NBP1-85272)

Find related products by research area.

Blogs on DHX29

There are no specific blogs for DHX29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DHX29 Antibody and receive a gift card or discount.


Gene Symbol DHX29