DHRS3 Antibody

Images

 
Western Blot: DHRS3 Antibody [NBP1-79192] - Mouse Spleen Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHRS3 Antibody Summary

Immunogen
The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHRS3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against Dhrs3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DHRS3 Antibody

  • DD83.1
  • dehydrogenase/reductase (SDR family) member 3
  • EC 1.1.1
  • EC 1.1.1.300
  • RDH17
  • Retinal short-chain dehydrogenase/reductase 1
  • RETSDR1
  • retSDR1short chain dehydrogenase/reductase family 16C, member 1
  • Rsdr1
  • SDR1
  • SDR16C1
  • short-chain dehydrogenase/reductase 1
  • short-chain dehydrogenase/reductase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-45516
Species: Hu
Applications: WB, ICC/IF, IHC
AF972
Species: Hu
Applications: WB, Simple Western, IHC, KO
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-56686
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready, ICC
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-52047
Species: Hu, Mu
Applications: WB, IHC, PEP-ELISA
MAB7515
Species: Hu
Applications: IHC
NBP1-85571
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye, Ze
Applications: WB
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DHRS3 Antibody (NBP1-79192) (0)

There are no publications for DHRS3 Antibody (NBP1-79192).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS3 Antibody (NBP1-79192) (0)

There are no reviews for DHRS3 Antibody (NBP1-79192). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRS3 Antibody (NBP1-79192) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHRS3 Products

Bioinformatics Tool for DHRS3 Antibody (NBP1-79192)

Discover related pathways, diseases and genes to DHRS3 Antibody (NBP1-79192). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRS3 Antibody (NBP1-79192)

Discover more about diseases related to DHRS3 Antibody (NBP1-79192).
 

Pathways for DHRS3 Antibody (NBP1-79192)

View related products by pathway.

PTMs for DHRS3 Antibody (NBP1-79192)

Learn more about PTMs related to DHRS3 Antibody (NBP1-79192).

Blogs on DHRS3

There are no specific blogs for DHRS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRS3
Uniprot