DGK-alpha Antibody


Western Blot: DGK-alpha Antibody [NBP1-58873] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related DGK-alpha Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DGK-alpha Antibody Summary

Synthetic peptides corresponding to DGKA(diacylglycerol kinase, alpha 80kDa) The peptide sequence was selected from the N terminal of DGKA. Peptide sequence EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DGKA and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DGK-alpha Antibody

  • DAG kinase alpha
  • DAGK
  • DAGK1
  • DAGK1diacylglycerol kinase, alpha (80kD)
  • DGKA
  • DGKalpha
  • DGK-alpha
  • DGK-alphaEC
  • diacylglycerol kinase alpha
  • diacylglycerol kinase, alpha 80kDa
  • Diglyceride kinase alpha
  • MGC12821,80 kDa diacylglycerol kinase
  • MGC42356


The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It acts as a modulator that competes with protein kinase C for the second messenger diacylglycerol in intracellular signaling pathways. It also plays an important rol


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, IA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for DGK-alpha Antibody (NBP1-58873) (0)

There are no publications for DGK-alpha Antibody (NBP1-58873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DGK-alpha Antibody (NBP1-58873) (0)

There are no reviews for DGK-alpha Antibody (NBP1-58873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DGK-alpha Antibody (NBP1-58873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DGK-alpha Products

Bioinformatics Tool for DGK-alpha Antibody (NBP1-58873)

Discover related pathways, diseases and genes to DGK-alpha Antibody (NBP1-58873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DGK-alpha Antibody (NBP1-58873)

Discover more about diseases related to DGK-alpha Antibody (NBP1-58873).

Pathways for DGK-alpha Antibody (NBP1-58873)

View related products by pathway.

PTMs for DGK-alpha Antibody (NBP1-58873)

Learn more about PTMs related to DGK-alpha Antibody (NBP1-58873).

Research Areas for DGK-alpha Antibody (NBP1-58873)

Find related products by research area.

Blogs on DGK-alpha

There are no specific blogs for DGK-alpha, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DGK-alpha Antibody and receive a gift card or discount.


Gene Symbol DGKA