DFNB31 Antibody

Images

 
Immunohistochemistry-Paraffin: DFNB31 Antibody [NBP1-85612] - Staining of human adrenal gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DFNB31 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAVRLLKSSRHLILTVKDVGRLPHARTTVDETKWIASSRIRETMANSAGFLGDLTTEGINKPGFYKGPAGSQVTLSSLGNQTRVLLEEQARHLLNEQEH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DFNB31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DFNB31 Recombinant Protein Antigen (NBP1-85612PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DFNB31 Antibody

  • Autosomal recessive deafness type 31 protein
  • CIP98DKFZp434N014
  • deafness, autosomal recessive 31
  • DFNB 31
  • KIAA1526whirlin
  • USH2DWI
  • whrn
  • WHRNCASK-interacting protein CIP98

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
H00051168-Q01
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89189
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-89076
Species: Hu
Applications: IHC, IHC-P

Publications for DFNB31 Antibody (NBP1-85612) (0)

There are no publications for DFNB31 Antibody (NBP1-85612).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DFNB31 Antibody (NBP1-85612) (0)

There are no reviews for DFNB31 Antibody (NBP1-85612). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DFNB31 Antibody (NBP1-85612) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DFNB31 Products

Bioinformatics Tool for DFNB31 Antibody (NBP1-85612)

Discover related pathways, diseases and genes to DFNB31 Antibody (NBP1-85612). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DFNB31 Antibody (NBP1-85612)

Discover more about diseases related to DFNB31 Antibody (NBP1-85612).
 

Pathways for DFNB31 Antibody (NBP1-85612)

View related products by pathway.

Research Areas for DFNB31 Antibody (NBP1-85612)

Find related products by research area.

Blogs on DFNB31

There are no specific blogs for DFNB31, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DFNB31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DFNB31