Recombinant Human Desmocollin-3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Desmocollin-3 Peptides and Proteins

Order Details


    • Catalog Number
      H00001825-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Desmocollin-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human DSC3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST

Protein/Peptide Type
Partial Recombinant Protein
Gene
DSC3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Desmocollin-3 Protein

  • Cadherin family member 3
  • CDHF3
  • CDHF3HT-CP
  • desmocollin 3
  • Desmocollin3
  • Desmocollin-3
  • desmocollin-4
  • DSC
  • DSC1
  • DSC2
  • DSC3
  • DSC4
  • DSC4desmocollin-3
  • HT-CP

Background

DSC3 - desmocollin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
MAB944
Species: Hu
Applications: WB, IHC
NBP1-78984
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF947
Species: Hu
Applications: WB, Simple Western
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
44260002
Species: Hu
Applications: WB, ELISA
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBL1-16214
Species: Hu
NBP2-12553
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01) (0)

There are no publications for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01) (0)

There are no reviews for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Desmocollin-3 Products

Bioinformatics Tool for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01)

Discover related pathways, diseases and genes to Desmocollin-3 Partial Recombinant Protein (H00001825-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01)

Discover more about diseases related to Desmocollin-3 Partial Recombinant Protein (H00001825-Q01).
 

Pathways for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01)

View related products by pathway.

PTMs for Desmocollin-3 Partial Recombinant Protein (H00001825-Q01)

Learn more about PTMs related to Desmocollin-3 Partial Recombinant Protein (H00001825-Q01).

Blogs on Desmocollin-3

There are no specific blogs for Desmocollin-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Desmocollin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DSC3
Entrez