Recombinant Human Dermatopontin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Dermatopontin Peptides and Proteins

Order Details


    • Catalog Number
      H00001805-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Dermatopontin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human DPT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DPT

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dermatopontin Protein

  • Dermatopontin
  • DPT
  • Eq1
  • TRAMP
  • Tyrosine-rich acidic matrix protein

Background

Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-85511
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89276
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13729
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001805-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Dermatopontin Partial Recombinant Protein (H00001805-Q01) (0)

There are no publications for Dermatopontin Partial Recombinant Protein (H00001805-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dermatopontin Partial Recombinant Protein (H00001805-Q01) (0)

There are no reviews for Dermatopontin Partial Recombinant Protein (H00001805-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dermatopontin Partial Recombinant Protein (H00001805-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dermatopontin Products

Bioinformatics Tool for Dermatopontin Partial Recombinant Protein (H00001805-Q01)

Discover related pathways, diseases and genes to Dermatopontin Partial Recombinant Protein (H00001805-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dermatopontin Partial Recombinant Protein (H00001805-Q01)

Discover more about diseases related to Dermatopontin Partial Recombinant Protein (H00001805-Q01).
 

Pathways for Dermatopontin Partial Recombinant Protein (H00001805-Q01)

View related products by pathway.

PTMs for Dermatopontin Partial Recombinant Protein (H00001805-Q01)

Learn more about PTMs related to Dermatopontin Partial Recombinant Protein (H00001805-Q01).

Blogs on Dermatopontin

There are no specific blogs for Dermatopontin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dermatopontin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DPT
Entrez