dedicator of cytokinesis 8 Antibody

Images

 
Western Blot: dedicator of cytokinesis 8 Antibody [NBP1-90452] - Analysis in control (vector only transfected HEK293T lysate) and dOCK8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: dedicator of cytokinesis 8 Antibody [NBP1-90452] - Staining of human bone marrow shows moderate cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

dedicator of cytokinesis 8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AIANSLHNSKDLSKDQHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARVMSSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGSSDAPSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOCK8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
dedicator of cytokinesis 8 Protein (NBP1-90452PEP)
Publications
Read Publications using
NBP1-90452 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25674539).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for dedicator of cytokinesis 8 Antibody

  • dedicator of cytokinesis 8
  • FLJ00026
  • FLJ00346

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90167
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-2307
Species: Hu
Applications: WB
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
H00058524-R01
Species: Hu
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-04508
Species: Hu
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90452
Species: Hu
Applications: WB, IHC, IHC-P

Publications for dedicator of cytokinesis 8 Antibody (NBP1-90452)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for dedicator of cytokinesis 8 Antibody (NBP1-90452) (0)

There are no reviews for dedicator of cytokinesis 8 Antibody (NBP1-90452). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for dedicator of cytokinesis 8 Antibody (NBP1-90452) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional dedicator of cytokinesis 8 Products

Bioinformatics Tool for dedicator of cytokinesis 8 Antibody (NBP1-90452)

Discover related pathways, diseases and genes to dedicator of cytokinesis 8 Antibody (NBP1-90452). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for dedicator of cytokinesis 8 Antibody (NBP1-90452)

Discover more about diseases related to dedicator of cytokinesis 8 Antibody (NBP1-90452).
 

Pathways for dedicator of cytokinesis 8 Antibody (NBP1-90452)

View related products by pathway.

PTMs for dedicator of cytokinesis 8 Antibody (NBP1-90452)

Learn more about PTMs related to dedicator of cytokinesis 8 Antibody (NBP1-90452).

Blogs on dedicator of cytokinesis 8

There are no specific blogs for dedicator of cytokinesis 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dedicator of cytokinesis 8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK8