DDX53 Antibody

Images

 
Western Blot: DDX53 Antibody [NBP2-84000] - Host: Rabbit. Target Name: DDX53. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX53 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX53. Peptide sequence: AGELIKILDRANQSVPEDLVVMAEQYKLNQQKRHRETRSRKPGQRRKEFY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DDX53
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX53 Antibody

  • CAGEprobable ATP-dependent RNA helicase DDX53
  • Cancer/testis antigen 26
  • Cancer-associated gene protein
  • CT26EC 3.6.4.13
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 53
  • DEAD box protein 53
  • DEAD box protein CAGE
  • DEAD-box protein CAGE
  • EC 3.6.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NBP2-56164
Species: Hu
Applications: ICC/IF, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
DY1090
Species: Hu
Applications: ELISA
NBP2-54724
Species: Hu
Applications: IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
2914-HT
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
6507-IL/CF
Species: Hu
Applications: BA

Publications for DDX53 Antibody (NBP2-84000) (0)

There are no publications for DDX53 Antibody (NBP2-84000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX53 Antibody (NBP2-84000) (0)

There are no reviews for DDX53 Antibody (NBP2-84000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX53 Antibody (NBP2-84000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX53 Products

Bioinformatics Tool for DDX53 Antibody (NBP2-84000)

Discover related pathways, diseases and genes to DDX53 Antibody (NBP2-84000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX53 Antibody (NBP2-84000)

Discover more about diseases related to DDX53 Antibody (NBP2-84000).
 

Pathways for DDX53 Antibody (NBP2-84000)

View related products by pathway.

PTMs for DDX53 Antibody (NBP2-84000)

Learn more about PTMs related to DDX53 Antibody (NBP2-84000).
 

Research Areas for DDX53 Antibody (NBP2-84000)

Find related products by research area.

Blogs on DDX53

There are no specific blogs for DDX53, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX53 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX53