DDX43 Antibody


Immunohistochemistry: DDX43 Antibody [NBP1-85420] - Staining of human testis shows distinct cytoplasmic positivity in seminiferous duct cells.

Product Details

Product Discontinued
View other related DDX43 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DDX43 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYNSEC
Specificity of human DDX43 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Read Publication using NBP1-85420.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DDX43 Antibody

  • Cancer/testis antigen 13
  • CT13DEAD-box protein 43
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
  • DEAD box protein 43
  • DKFZp434H2114
  • EC 3.6.1
  • EC
  • HAGEDEAD box protein HAGE
  • Helical antigen
  • probable ATP-dependent RNA helicase DDX43


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC, IHC-P

Publications for DDX43 Antibody (NBP1-85420)(1)

Reviews for DDX43 Antibody (NBP1-85420) (0)

There are no reviews for DDX43 Antibody (NBP1-85420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DDX43 Antibody (NBP1-85420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DDX43 Products

Bioinformatics Tool for DDX43 Antibody (NBP1-85420)

Discover related pathways, diseases and genes to DDX43 Antibody (NBP1-85420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX43 Antibody (NBP1-85420)

Discover more about diseases related to DDX43 Antibody (NBP1-85420).

Pathways for DDX43 Antibody (NBP1-85420)

View related products by pathway.

PTMs for DDX43 Antibody (NBP1-85420)

Learn more about PTMs related to DDX43 Antibody (NBP1-85420).

Blogs on DDX43

There are no specific blogs for DDX43, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX43 Antibody and receive a gift card or discount.


Gene Symbol DDX43