DDX43 Antibody

Images

 
Immunohistochemistry: DDX43 Antibody [NBP1-85420] - Staining of human testis shows distinct cytoplasmic positivity in seminiferous duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FALKSHFVGAVIGRGGSKIKNIQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDNFVKKLEENYNSEC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DDX43 Protein (NBP1-85420PEP)
Publications
Read Publication using NBP1-85420.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDX43 Antibody

  • Cancer/testis antigen 13
  • CT13DEAD-box protein 43
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
  • DEAD box protein 43
  • DKFZp434H2114
  • EC 3.6.1
  • EC 3.6.4.13
  • HAGEDEAD box protein HAGE
  • Helical antigen
  • probable ATP-dependent RNA helicase DDX43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00002543-T01
Species: Hu
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00168400-D01P
Species: Hu
Applications: WB, ELISA
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-97821
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22294
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-125
Species: Hu
Applications: WB, ICC/IF
H00001646-M03
Species: Hu
Applications: WB, ELISA
NBP1-85420
Species: Hu
Applications: IHC, IHC-P

Publications for DDX43 Antibody (NBP1-85420)(1)

Reviews for DDX43 Antibody (NBP1-85420) (0)

There are no reviews for DDX43 Antibody (NBP1-85420). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DDX43 Antibody (NBP1-85420) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX43 Products

Bioinformatics Tool for DDX43 Antibody (NBP1-85420)

Discover related pathways, diseases and genes to DDX43 Antibody (NBP1-85420). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX43 Antibody (NBP1-85420)

Discover more about diseases related to DDX43 Antibody (NBP1-85420).
 

Pathways for DDX43 Antibody (NBP1-85420)

View related products by pathway.

PTMs for DDX43 Antibody (NBP1-85420)

Learn more about PTMs related to DDX43 Antibody (NBP1-85420).

Blogs on DDX43

There are no specific blogs for DDX43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX43