DDX24 Antibody

Images

 
Western Blot: DDX24 Antibody [NBP1-57208] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related DDX24 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57208
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DDX24 Antibody Summary

Immunogen
Synthetic peptides corresponding to DDX24(DEAD (Asp-Glu-Ala-Asp) box polypeptide 24) The peptide sequence was selected from the middle region of DDX24. Peptide sequence ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK.
Clonality
Polyclonal
Host
Rabbit
Gene
DDX24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against DDX24 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDX24 Antibody

  • ATP-dependent RNA helicase DDX24
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
  • DEAD box protein 24
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24
  • EC 3.6.1
  • EC 3.6.4.13
  • S. cerevisiae CHL1-like helicase

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX24 Antibody (NBP1-57208) (0)

There are no publications for DDX24 Antibody (NBP1-57208).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX24 Antibody (NBP1-57208) (0)

There are no reviews for DDX24 Antibody (NBP1-57208). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX24 Antibody (NBP1-57208) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX24 Products

Bioinformatics Tool for DDX24 Antibody (NBP1-57208)

Discover related pathways, diseases and genes to DDX24 Antibody (NBP1-57208). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX24 Antibody (NBP1-57208)

Discover more about diseases related to DDX24 Antibody (NBP1-57208).
 

Pathways for DDX24 Antibody (NBP1-57208)

View related products by pathway.

Research Areas for DDX24 Antibody (NBP1-57208)

Find related products by research area.

Blogs on DDX24

There are no specific blogs for DDX24, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX24
Uniprot