DDX24 Antibody



Product Details

Product Discontinued
View other related DDX24 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DDX24 Antibody Summary

Synthetic peptides corresponding to DDX24(DEAD (Asp-Glu-Ala-Asp) box polypeptide 24) The peptide sequence was selected from the middle region of DDX24. Peptide sequence ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against DDX24 and was validated on Western blot.


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.


DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DDX24 Antibody (NBP1-57208) (0)

There are no publications for DDX24 Antibody (NBP1-57208).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX24 Antibody (NBP1-57208) (0)

There are no reviews for DDX24 Antibody (NBP1-57208). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for DDX24 Antibody (NBP1-57208) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX24 Antibody Products

Bioinformatics Tool for DDX24 Antibody (NBP1-57208)

Discover related pathways, diseases and genes to DDX24 Antibody (NBP1-57208). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX24 Antibody (NBP1-57208)

Discover more about diseases related to DDX24 Antibody (NBP1-57208).

Pathways for DDX24 Antibody (NBP1-57208)

View related products by pathway.

Blogs on DDX24

There are no specific blogs for DDX24, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol DDX24

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-57208 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.