Recombinant Human DDX11 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DDX11 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human DDX11 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GIFESPTGTGKSLSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKKEERDLVDR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DDX11
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDX11 Protein

  • CHL1CHL1-related helicase gene-1
  • CHL1-related protein 1
  • CHLR1MGC9335
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase)
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
  • DEAD/H box protein 11
  • EC 3.6.1
  • EC 3.6.1.23
  • EC 3.6.1.7
  • EC 3.6.4.13
  • hCHLR1
  • Keratinocyte growth factor-regulated gene 2 protein
  • KRG-2
  • KRG2CHL1-like helicase homolog
  • MGC133249
  • probable ATP-dependent RNA helicase DDX11

Background

DDX11 - DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-03346
Species: Hu
Applications: WB, IHC-P, IP, PLA
AF5890
Species: Mu
Applications: WB, Simple Western, IHC
AF5495
Species: Mu
Applications: WB, IHC
H00004782-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-87957
Species: Hu
Applications: IHC, IHC-P
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15039
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22360
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for DDX11 Partial Recombinant Protein (H00001663-Q01) (0)

There are no publications for DDX11 Partial Recombinant Protein (H00001663-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX11 Partial Recombinant Protein (H00001663-Q01) (0)

There are no reviews for DDX11 Partial Recombinant Protein (H00001663-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX11 Partial Recombinant Protein (H00001663-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX11 Products

Bioinformatics Tool for DDX11 Partial Recombinant Protein (H00001663-Q01)

Discover related pathways, diseases and genes to DDX11 Partial Recombinant Protein (H00001663-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX11 Partial Recombinant Protein (H00001663-Q01)

Discover more about diseases related to DDX11 Partial Recombinant Protein (H00001663-Q01).
 

Pathways for DDX11 Partial Recombinant Protein (H00001663-Q01)

View related products by pathway.

PTMs for DDX11 Partial Recombinant Protein (H00001663-Q01)

Learn more about PTMs related to DDX11 Partial Recombinant Protein (H00001663-Q01).

Blogs on DDX11

There are no specific blogs for DDX11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX11 Antibody (3C1)
H00001663-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DDX11 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX11