Recombinant Human DCBLD2/ESDN Protein

Images

 

Product Details

Summary
Product Discontinued
View other related DCBLD2/ESDN Peptides and Proteins

Order Details


    • Catalog Number
      H00131566-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human DCBLD2/ESDN Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 775 of Human DCBLD2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DCBLD2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DCBLD2/ESDN Protein

  • CLCP1
  • CLCP11700055P21Rik
  • CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
  • DCBLD2
  • discoidin, CUB and LCCL domain containing 2
  • discoidin, CUB and LCCL domain-containing protein 2
  • Endothelial and smooth muscle cell-derived neuropilin-like protein
  • ESDN
  • ESDNcoagulation factor V/VIII-homology domains protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77022
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for DCBLD2/ESDN Recombinant Protein (H00131566-P01) (0)

There are no publications for DCBLD2/ESDN Recombinant Protein (H00131566-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCBLD2/ESDN Recombinant Protein (H00131566-P01) (0)

There are no reviews for DCBLD2/ESDN Recombinant Protein (H00131566-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DCBLD2/ESDN Recombinant Protein (H00131566-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCBLD2/ESDN Products

Bioinformatics Tool for DCBLD2/ESDN Recombinant Protein (H00131566-P01)

Discover related pathways, diseases and genes to DCBLD2/ESDN Recombinant Protein (H00131566-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCBLD2/ESDN Recombinant Protein (H00131566-P01)

Discover more about diseases related to DCBLD2/ESDN Recombinant Protein (H00131566-P01).
 

Pathways for DCBLD2/ESDN Recombinant Protein (H00131566-P01)

View related products by pathway.

PTMs for DCBLD2/ESDN Recombinant Protein (H00131566-P01)

Learn more about PTMs related to DCBLD2/ESDN Recombinant Protein (H00131566-P01).
 

Research Areas for DCBLD2/ESDN Recombinant Protein (H00131566-P01)

Find related products by research area.

Blogs on DCBLD2/ESDN

There are no specific blogs for DCBLD2/ESDN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DCBLD2/ESDN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DCBLD2
Entrez