DCAMKL2 Antibody (2A5) - Azide and BSA Free

Western Blot: DCAMKL2 Antibody (2A5) [H00166614-M01] - Detection against Immunogen (36.01 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DCAMKL2 Antibody (2A5) - Azide and BSA Free Summary

• Immunogen: DCAMKL2 (AAH32726, 348 a.a. ~ 438 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE*
• Specificity: DCAMKL2 - doublecortin and CaM kinase-like 2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DCLK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCAMKL2 Antibody (2A5) - Azide and BSA Free

• CL2EC 2.7.11.1
• CLICK-II
• CLIK2
• DCDC3
• DCDC3BCaMK-like CREB regulatory kinase 2
• DCK2DCAMKL2
• DKFZp761I032
• doublecortin and CaM kinase-like 2
• Doublecortin domain-containing protein 3B
• Doublecortin-like and CAM kinase-like 2
• doublecortin-like kinase 2CLICK2
• EC 2.7.11
• MGC45428
• serine/threonine-protein kinase DCLK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCLK2
• Entrez:
  • 166614(Human)