DBNDD1 Antibody

Images

 
Western Blot: DBNDD1 Antibody [NBP1-82292] - Analysis in control (vector only transfected HEK293T lysate) and DBNDD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: DBNDD1 Antibody [NBP1-82292] - Staining of human cell line U-251 MG shows positivity in nucleus.
Immunohistochemistry-Paraffin: DBNDD1 Antibody [NBP1-82292] - Staining of human breast shows strong nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBNDD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSDQELAEVFADSDDENLNTESPAGLHPLPRAGYLRSPSWTRTRAEQSHEKQPLGDPERQATVLDTFLTVE
Specificity
Specificity of human DBNDD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBNDD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DBNDD1 Antibody

  • dysbindin (dystrobrevin binding protein 1) domain containing 1
  • dysbindin domain-containing protein 1
  • FLJ12582
  • MGC3101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00574
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47261
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1195
Species: Multi
Applications: WB, Simple Western, IHC, ICC
NB100-2564
Species: Hu
Applications: WB
NBP1-92211
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NLS1040
Species: Hu, Mk
Applications: IHC, IHC-P

Publications for DBNDD1 Antibody (NBP1-82292) (0)

There are no publications for DBNDD1 Antibody (NBP1-82292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBNDD1 Antibody (NBP1-82292) (0)

There are no reviews for DBNDD1 Antibody (NBP1-82292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DBNDD1 Antibody (NBP1-82292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBNDD1 Products

Bioinformatics Tool for DBNDD1 Antibody (NBP1-82292)

Discover related pathways, diseases and genes to DBNDD1 Antibody (NBP1-82292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DBNDD1

There are no specific blogs for DBNDD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBNDD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBNDD1