DAZ1 Antibody (3G10) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related DAZ1 Primary Antibodies

Order Details


    • Catalog Number
      H00001617-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DAZ1 Antibody (3G10) [DyLight 405] Summary

Immunogen
DAZ1 (AAH18119, 21 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
Specificity
DAZ1 - deleted in azoospermia 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DAZ1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against tissue lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAZ1 Antibody (3G10) [DyLight 405]

  • deleted in azoospermia 1
  • deleted in azoospermia
  • FLJ17175
  • SPGYDAZdeleted in azoospermia protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2437
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46582
Species: Hu
Applications: WB, IHC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-80443
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NBP1-32780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-79749
Species: Hu
Applications: WB
NBP1-98290
Species: Hu
Applications: WB
NBP2-16103
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009426-R01
Species: Hu
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP1-57481
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
22240002
Species: Hu
Applications: WB, ELISA

Publications for DAZ1 Antibody (H00001617-M01V) (0)

There are no publications for DAZ1 Antibody (H00001617-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAZ1 Antibody (H00001617-M01V) (0)

There are no reviews for DAZ1 Antibody (H00001617-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAZ1 Antibody (H00001617-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAZ1 Antibody (3G10) [DyLight 405] Products

DAZ1 H00001617-M01V

Related Products by Gene

Bioinformatics Tool for DAZ1 Antibody (H00001617-M01V)

Discover related pathways, diseases and genes to DAZ1 Antibody (H00001617-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAZ1 Antibody (H00001617-M01V)

Discover more about diseases related to DAZ1 Antibody (H00001617-M01V).
 

Pathways for DAZ1 Antibody (H00001617-M01V)

View related products by pathway.

PTMs for DAZ1 Antibody (H00001617-M01V)

Learn more about PTMs related to DAZ1 Antibody (H00001617-M01V).

Blogs on DAZ1

There are no specific blogs for DAZ1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our DAZ1 Antibody (3G10) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol DAZ1